Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9471
Gene name
LocationContig_692:741..4701
Strand+
Gene length (bp)3960
Transcript length (bp)3657
Coding sequence length (bp)3657
Protein length (aa) 1219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16879 Sin3a_C C-terminal domain of Sin3a protein 5.6E-69 870 1142
PF08295 Sin3_corepress Sin3 family co-repressor 3.2E-39 462 554
PF02671 PAH Paired amphipathic helix repeat 6.1E-11 1 36
PF02671 PAH Paired amphipathic helix repeat 2.5E-17 204 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09750|PST1_SCHPO Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst1 PE=1 SV=1 1 1192 0.0E+00
sp|P22579|SIN3_YEAST Transcriptional regulatory protein SIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIN3 PE=1 SV=2 1 1113 0.0E+00
sp|Q60520|SIN3A_MOUSE Paired amphipathic helix protein Sin3a OS=Mus musculus GN=Sin3a PE=1 SV=3 1 727 1.0E-100
sp|Q96ST3|SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens GN=SIN3A PE=1 SV=2 1 727 8.0E-93
sp|Q62141|SIN3B_MOUSE Paired amphipathic helix protein Sin3b OS=Mus musculus GN=Sin3b PE=1 SV=2 183 761 1.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09750|PST1_SCHPO Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst1 PE=1 SV=1 1 1192 0.0E+00
sp|P22579|SIN3_YEAST Transcriptional regulatory protein SIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIN3 PE=1 SV=2 1 1113 0.0E+00
sp|Q60520|SIN3A_MOUSE Paired amphipathic helix protein Sin3a OS=Mus musculus GN=Sin3a PE=1 SV=3 1 727 1.0E-100
sp|Q96ST3|SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens GN=SIN3A PE=1 SV=2 1 727 8.0E-93
sp|Q62141|SIN3B_MOUSE Paired amphipathic helix protein Sin3b OS=Mus musculus GN=Sin3b PE=1 SV=2 183 761 1.0E-79
sp|O75182|SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens GN=SIN3B PE=1 SV=2 183 731 2.0E-75
sp|O74755|PST3_SCHPO Paired amphipathic helix protein pst3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst3 PE=3 SV=1 1 1099 5.0E-74
sp|O13919|PST2_SCHPO Paired amphipathic helix protein pst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst2 PE=1 SV=1 190 1143 3.0E-69
sp|Q9LFQ3|SNL2_ARATH Paired amphipathic helix protein Sin3-like 2 OS=Arabidopsis thaliana GN=SNL2 PE=1 SV=2 180 787 1.0E-52
sp|Q9SRH9|SNL1_ARATH Paired amphipathic helix protein Sin3-like 1 OS=Arabidopsis thaliana GN=SNL1 PE=1 SV=2 180 738 4.0E-52
sp|O04539|SNL4_ARATH Paired amphipathic helix protein Sin3-like 4 OS=Arabidopsis thaliana GN=SNL4 PE=3 SV=3 372 731 4.0E-35
sp|O48686|SNL3_ARATH Paired amphipathic helix protein Sin3-like 3 OS=Arabidopsis thaliana GN=SNL3 PE=1 SV=3 448 731 2.0E-32
sp|Q9XIE1|SNL5_ARATH Paired amphipathic helix protein Sin3-like 5 OS=Arabidopsis thaliana GN=SNL5 PE=2 SV=3 439 772 3.0E-30
sp|Q9XIK6|SNL6_ARATH Paired amphipathic helix protein Sin3-like 6 OS=Arabidopsis thaliana GN=SNL6 PE=3 SV=2 450 704 2.0E-29
sp|O48686|SNL3_ARATH Paired amphipathic helix protein Sin3-like 3 OS=Arabidopsis thaliana GN=SNL3 PE=1 SV=3 183 434 3.0E-23
sp|O04539|SNL4_ARATH Paired amphipathic helix protein Sin3-like 4 OS=Arabidopsis thaliana GN=SNL4 PE=3 SV=3 180 255 9.0E-15
sp|Q9XIE1|SNL5_ARATH Paired amphipathic helix protein Sin3-like 5 OS=Arabidopsis thaliana GN=SNL5 PE=2 SV=3 180 317 6.0E-13
sp|Q9XIK6|SNL6_ARATH Paired amphipathic helix protein Sin3-like 6 OS=Arabidopsis thaliana GN=SNL6 PE=3 SV=2 183 261 7.0E-12
sp|O75182|SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens GN=SIN3B PE=1 SV=2 1 43 1.0E-11
sp|Q62141|SIN3B_MOUSE Paired amphipathic helix protein Sin3b OS=Mus musculus GN=Sin3b PE=1 SV=2 1 43 1.0E-11
sp|Q9LFQ3|SNL2_ARATH Paired amphipathic helix protein Sin3-like 2 OS=Arabidopsis thaliana GN=SNL2 PE=1 SV=2 1 42 2.0E-10
sp|Q9SRH9|SNL1_ARATH Paired amphipathic helix protein Sin3-like 1 OS=Arabidopsis thaliana GN=SNL1 PE=1 SV=2 1 42 2.0E-10
sp|O48686|SNL3_ARATH Paired amphipathic helix protein Sin3-like 3 OS=Arabidopsis thaliana GN=SNL3 PE=1 SV=3 1 42 1.0E-09
sp|Q9XIE1|SNL5_ARATH Paired amphipathic helix protein Sin3-like 5 OS=Arabidopsis thaliana GN=SNL5 PE=2 SV=3 1 42 7.0E-09
sp|O04539|SNL4_ARATH Paired amphipathic helix protein Sin3-like 4 OS=Arabidopsis thaliana GN=SNL4 PE=3 SV=3 1 42 2.0E-08
sp|Q9XIK6|SNL6_ARATH Paired amphipathic helix protein Sin3-like 6 OS=Arabidopsis thaliana GN=SNL6 PE=3 SV=2 1 42 2.0E-08
sp|O74755|PST3_SCHPO Paired amphipathic helix protein pst3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst3 PE=3 SV=1 182 306 2.0E-07
sp|Q96ST3|SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens GN=SIN3A PE=1 SV=2 139 249 4.0E-07
sp|Q60520|SIN3A_MOUSE Paired amphipathic helix protein Sin3a OS=Mus musculus GN=Sin3a PE=1 SV=3 139 249 4.0E-07
sp|Q09750|PST1_SCHPO Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst1 PE=1 SV=1 188 297 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0031326 regulation of cellular biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9471
MKDFKSQAIDTPGVINRVSELFAGHPNLIQGFNTFLPPGYRIECGAGNDPNTIRVTTPMGTTVQSIAGRGIQSDG
HGPPVAAQPPFPERGGGQWPQRPQHGVESPEASFSTPAQNGATLFVQAAAQNAASFDVPGSQRNASQMPGNAGPG
GAPAVRGAQTPAPGAGPGGVNGSQANMERRGPVEFNHAISYVNKIKNRFQDKPEIYKQFLEILQTYQREQKPIQD
VYAQVTTLFNSAPDLLEDFKQFLPESAGQAKAAQARLEDGVPPGPSHTPQPGMRDGQKMPPLGSFAPPASASKDK
KRPRTDKQAQGAEALLAETVATGRLQPSIVNGNKRPKLSHARGAGDAAAPIEPTLTPVMPEPYQPRASATSNQEE
IAFFERVKKFLSNRSSMNDFLKLCNLFSQNIIDRNTLFHKGALFIGANPDLMSFWKTFVGVDSQDVIVDNRPAPP
TEKLSLSNCRGYGPSYRLLPKRERLKPCSGRDELCNSVLNDQWASHPTWASEDSGFVAHRKNQFEEGLHRIEEER
HDYDFNIEINLKCIQLLEPVAQQMLAMSPVERETFHMPAALAGQSTSIFKRICKKIYGDRGIDVVNDMFSHPFDV
VPVLLTRMKQKDEEWRFSQREWEKVWHAQTEHMYLKSLDHMGILVKSNDKRNLTAKHLVDVIKTKHEEQRRERAL
KGKAPRYQLVWDFGDKDVILDLLRLMMLYPLHSGQHSAQEKERLLEFFESFVATFFDLNEEVVQERVPKIPPDSA
EEEVEESTPAELTNGRGKRNGKRGDLLRGVLDPGRNGSKPRSQKEDSAASGSKETTPDVGSANEEEMADAPDDAA
ATEVSNERWMPTVPKPVVVDGDNSLLDAEGELRADGFFRRPWYNFFANQTIFVFFSIFQTIYSRLVEVKGSKDIV
SREIDRLSRPKPARDIGFADTVMNYFDPSDDSDKFWPKTVELLEDYITGELEEARYQEVLRHYYLRSGWKLYTIQ
DQLKTLCRLALTCSSNDAKEKTPDLIHQYFVGREKDETSYQTEISARKFAEKCVKDGDIFVICWFPLKAEATVRW
LQRNDTTFYMDEMQMRERWQYYISSFIRVEPTEGIPRSKLQKVVLTRNMPSGDGDSDEDNAPKPLLYSENLTTSI
CLKSSKMVWAPGTSEYFIYDQAPRTAEARERADRMRLALGCAREGRMLERLVQNPPWAKELPEDRVREYVDDFER
WKREGVRAASADGGGDTE*
Coding >Hirsu2|9471
ATGAAAGACTTCAAGAGCCAGGCGATCGACACGCCAGGCGTGATCAACAGAGTGTCGGAGCTCTTTGCTGGACAC
CCCAATCTTATCCAGGGCTTCAACACCTTCCTCCCGCCTGGCTACAGGATTGAGTGCGGCGCTGGGAACGATCCC
AACACCATACGGGTCACCACCCCGATGGGCACCACTGTCCAGTCGATTGCCGGGCGTGGAATCCAGAGCGATGGC
CACGGTCCCCCCGTTGCTGCCCAGCCCCCATTCCCCGAGCGCGGCGGCGGGCAGTGGCCGCAGAGACCTCAGCAC
GGCGTCGAGAGCCCTGAAGCCAGCTTCAGCACTCCGGCGCAGAACGGCGCCACCCTCTTCGTTCAGGCTGCCGCG
CAGAATGCCGCCTCCTTCGACGTCCCCGGCTCGCAGAGGAACGCGTCGCAGATGCCGGGCAACGCCGGCCCTGGC
GGCGCTCCGGCAGTACGCGGCGCTCAGACCCCAGCTCCCGGCGCCGGGCCGGGCGGCGTCAATGGCAGTCAAGCC
AACATGGAGCGTAGGGGCCCCGTCGAGTTCAACCATGCCATCAGTTACGTCAACAAGATAAAGAATCGTTTCCAG
GACAAGCCAGAAATCTACAAGCAGTTCCTGGAGATCCTGCAGACGTATCAACGAGAACAGAAGCCGATTCAGGAC
GTTTACGCTCAGGTCACGACCCTCTTCAACTCGGCCCCGGATCTCCTGGAGGATTTCAAGCAGTTCCTTCCAGAG
TCGGCCGGCCAGGCCAAGGCAGCCCAAGCAAGGCTGGAGGACGGGGTGCCGCCGGGTCCGAGTCATACCCCGCAG
CCGGGCATGCGTGATGGCCAGAAGATGCCTCCTCTGGGGAGCTTCGCCCCGCCTGCGAGCGCGAGCAAAGATAAG
AAACGGCCACGCACCGACAAGCAGGCCCAAGGCGCCGAGGCGCTGCTGGCCGAAACGGTGGCGACCGGCCGTCTT
CAGCCGTCCATCGTGAATGGCAACAAGCGGCCCAAGCTGAGCCATGCCAGGGGCGCTGGCGATGCCGCGGCCCCG
ATCGAGCCCACGCTCACGCCCGTCATGCCCGAGCCGTATCAGCCACGCGCCTCGGCGACCTCGAACCAAGAGGAG
ATTGCCTTTTTCGAACGCGTCAAGAAGTTCCTGAGCAACAGGTCTTCCATGAACGACTTTCTCAAACTATGCAAC
CTATTCAGCCAGAACATCATCGATCGAAACACACTCTTCCACAAGGGCGCCCTGTTCATCGGTGCGAACCCGGAT
CTCATGAGTTTCTGGAAGACATTCGTCGGCGTCGACTCGCAGGATGTCATAGTGGACAACCGTCCCGCGCCGCCC
ACGGAGAAGCTATCGCTGAGCAACTGTCGGGGTTACGGACCCAGCTACAGGCTGCTGCCCAAACGGGAGCGCCTC
AAGCCGTGCAGCGGACGCGATGAGCTGTGCAACTCGGTCCTGAACGATCAGTGGGCATCTCATCCCACCTGGGCC
AGCGAGGATTCCGGATTCGTGGCGCACCGGAAGAACCAGTTCGAGGAAGGCCTGCACCGCATCGAGGAGGAGCGC
CACGACTACGATTTCAACATCGAGATCAACCTCAAGTGCATCCAGCTGCTCGAACCCGTCGCGCAGCAGATGCTG
GCCATGTCTCCGGTCGAGAGGGAGACGTTCCACATGCCGGCCGCCCTGGCAGGCCAGAGCACCTCCATCTTCAAG
CGCATCTGCAAGAAGATCTACGGGGACAGGGGCATCGACGTCGTCAACGACATGTTCAGCCACCCGTTCGACGTG
GTGCCCGTCCTGCTCACGCGCATGAAGCAGAAGGATGAGGAGTGGCGCTTCTCCCAGCGCGAGTGGGAGAAGGTG
TGGCACGCGCAGACGGAGCACATGTACCTCAAGAGCCTCGACCACATGGGCATACTGGTCAAGAGCAACGACAAG
AGGAACCTGACGGCCAAGCACCTCGTCGACGTCATCAAGACCAAGCACGAGGAACAGCGACGGGAGCGCGCCCTC
AAGGGCAAGGCGCCGCGCTACCAGCTCGTCTGGGACTTTGGCGACAAGGACGTCATCCTCGACCTGCTGCGCCTG
ATGATGCTCTATCCCCTCCACAGCGGCCAGCATAGCGCGCAGGAAAAGGAGAGGCTCTTGGAGTTCTTCGAGTCG
TTCGTCGCTACCTTCTTCGACCTCAACGAGGAGGTGGTGCAGGAGCGGGTGCCTAAGATCCCCCCCGACTCGGCC
GAGGAGGAGGTGGAAGAGTCGACGCCGGCGGAGCTGACCAACGGCCGCGGCAAACGGAATGGCAAGCGAGGAGAC
CTCCTCCGAGGCGTCCTCGACCCCGGCCGCAACGGCAGCAAGCCGCGCAGCCAGAAGGAGGACAGCGCGGCGTCG
GGGAGCAAGGAGACGACGCCCGACGTCGGATCGGCCAACGAAGAAGAGATGGCCGACGCGCCCGACGACGCGGCC
GCCACCGAGGTGTCCAACGAGCGGTGGATGCCGACGGTGCCCAAGCCGGTCGTCGTCGACGGCGACAACTCGCTC
CTCGACGCCGAGGGCGAGCTCAGGGCTGACGGCTTCTTCCGCCGCCCCTGGTACAACTTCTTTGCCAACCAGACC
ATCTTCGTGTTTTTCAGCATCTTCCAGACCATCTACAGCCGGCTCGTGGAGGTCAAGGGCAGTAAGGACATCGTC
TCGCGCGAGATCGACCGCCTCAGCCGGCCCAAGCCGGCCAGGGACATCGGATTCGCCGACACCGTCATGAACTAC
TTCGACCCCAGCGACGACTCGGACAAGTTCTGGCCGAAGACGGTGGAGCTCCTCGAGGACTACATCACAGGCGAG
CTCGAGGAGGCGCGGTACCAGGAAGTGCTGCGCCACTACTACCTGCGCAGCGGCTGGAAGCTCTACACCATCCAG
GACCAGCTCAAGACGCTGTGTCGTCTAGCGCTCACGTGCAGCAGCAACGACGCGAAGGAGAAGACGCCGGACCTG
ATCCACCAATACTTCGTGGGCCGCGAGAAGGACGAGACCAGCTATCAGACCGAGATCAGTGCGCGCAAGTTTGCC
GAGAAGTGTGTCAAGGACGGCGACATTTTTGTGATTTGCTGGTTCCCGCTCAAGGCCGAGGCCACGGTGCGCTGG
CTGCAGCGGAACGACACGACCTTCTACATGGACGAGATGCAGATGCGCGAGCGCTGGCAGTACTACATCTCGTCC
TTCATCCGGGTCGAGCCGACGGAGGGCATCCCGCGGTCCAAGCTGCAAAAGGTGGTGTTGACGCGCAACATGCCG
TCGGGCGACGGCGACTCGGACGAGGACAACGCGCCGAAGCCGCTGCTGTACAGTGAGAACCTGACGACGAGCATC
TGCCTCAAGAGCTCCAAGATGGTCTGGGCGCCCGGCACGTCCGAGTACTTCATCTACGACCAGGCGCCGCGGACG
GCCGAGGCCCGCGAGCGCGCCGACCGGATGCGCCTCGCCCTCGGCTGCGCGCGCGAGGGCCGCATGCTCGAGCGC
CTGGTGCAGAACCCGCCTTGGGCCAAGGAGCTGCCCGAGGACCGGGTGCGCGAGTACGTCGACGACTTTGAGCGC
TGGAAGCGCGAGGGCGTGCGGGCGGCGTCGGCCGATGGCGGCGGCGACACGGAGTGA
Transcript >Hirsu2|9471
ATGAAAGACTTCAAGAGCCAGGCGATCGACACGCCAGGCGTGATCAACAGAGTGTCGGAGCTCTTTGCTGGACAC
CCCAATCTTATCCAGGGCTTCAACACCTTCCTCCCGCCTGGCTACAGGATTGAGTGCGGCGCTGGGAACGATCCC
AACACCATACGGGTCACCACCCCGATGGGCACCACTGTCCAGTCGATTGCCGGGCGTGGAATCCAGAGCGATGGC
CACGGTCCCCCCGTTGCTGCCCAGCCCCCATTCCCCGAGCGCGGCGGCGGGCAGTGGCCGCAGAGACCTCAGCAC
GGCGTCGAGAGCCCTGAAGCCAGCTTCAGCACTCCGGCGCAGAACGGCGCCACCCTCTTCGTTCAGGCTGCCGCG
CAGAATGCCGCCTCCTTCGACGTCCCCGGCTCGCAGAGGAACGCGTCGCAGATGCCGGGCAACGCCGGCCCTGGC
GGCGCTCCGGCAGTACGCGGCGCTCAGACCCCAGCTCCCGGCGCCGGGCCGGGCGGCGTCAATGGCAGTCAAGCC
AACATGGAGCGTAGGGGCCCCGTCGAGTTCAACCATGCCATCAGTTACGTCAACAAGATAAAGAATCGTTTCCAG
GACAAGCCAGAAATCTACAAGCAGTTCCTGGAGATCCTGCAGACGTATCAACGAGAACAGAAGCCGATTCAGGAC
GTTTACGCTCAGGTCACGACCCTCTTCAACTCGGCCCCGGATCTCCTGGAGGATTTCAAGCAGTTCCTTCCAGAG
TCGGCCGGCCAGGCCAAGGCAGCCCAAGCAAGGCTGGAGGACGGGGTGCCGCCGGGTCCGAGTCATACCCCGCAG
CCGGGCATGCGTGATGGCCAGAAGATGCCTCCTCTGGGGAGCTTCGCCCCGCCTGCGAGCGCGAGCAAAGATAAG
AAACGGCCACGCACCGACAAGCAGGCCCAAGGCGCCGAGGCGCTGCTGGCCGAAACGGTGGCGACCGGCCGTCTT
CAGCCGTCCATCGTGAATGGCAACAAGCGGCCCAAGCTGAGCCATGCCAGGGGCGCTGGCGATGCCGCGGCCCCG
ATCGAGCCCACGCTCACGCCCGTCATGCCCGAGCCGTATCAGCCACGCGCCTCGGCGACCTCGAACCAAGAGGAG
ATTGCCTTTTTCGAACGCGTCAAGAAGTTCCTGAGCAACAGGTCTTCCATGAACGACTTTCTCAAACTATGCAAC
CTATTCAGCCAGAACATCATCGATCGAAACACACTCTTCCACAAGGGCGCCCTGTTCATCGGTGCGAACCCGGAT
CTCATGAGTTTCTGGAAGACATTCGTCGGCGTCGACTCGCAGGATGTCATAGTGGACAACCGTCCCGCGCCGCCC
ACGGAGAAGCTATCGCTGAGCAACTGTCGGGGTTACGGACCCAGCTACAGGCTGCTGCCCAAACGGGAGCGCCTC
AAGCCGTGCAGCGGACGCGATGAGCTGTGCAACTCGGTCCTGAACGATCAGTGGGCATCTCATCCCACCTGGGCC
AGCGAGGATTCCGGATTCGTGGCGCACCGGAAGAACCAGTTCGAGGAAGGCCTGCACCGCATCGAGGAGGAGCGC
CACGACTACGATTTCAACATCGAGATCAACCTCAAGTGCATCCAGCTGCTCGAACCCGTCGCGCAGCAGATGCTG
GCCATGTCTCCGGTCGAGAGGGAGACGTTCCACATGCCGGCCGCCCTGGCAGGCCAGAGCACCTCCATCTTCAAG
CGCATCTGCAAGAAGATCTACGGGGACAGGGGCATCGACGTCGTCAACGACATGTTCAGCCACCCGTTCGACGTG
GTGCCCGTCCTGCTCACGCGCATGAAGCAGAAGGATGAGGAGTGGCGCTTCTCCCAGCGCGAGTGGGAGAAGGTG
TGGCACGCGCAGACGGAGCACATGTACCTCAAGAGCCTCGACCACATGGGCATACTGGTCAAGAGCAACGACAAG
AGGAACCTGACGGCCAAGCACCTCGTCGACGTCATCAAGACCAAGCACGAGGAACAGCGACGGGAGCGCGCCCTC
AAGGGCAAGGCGCCGCGCTACCAGCTCGTCTGGGACTTTGGCGACAAGGACGTCATCCTCGACCTGCTGCGCCTG
ATGATGCTCTATCCCCTCCACAGCGGCCAGCATAGCGCGCAGGAAAAGGAGAGGCTCTTGGAGTTCTTCGAGTCG
TTCGTCGCTACCTTCTTCGACCTCAACGAGGAGGTGGTGCAGGAGCGGGTGCCTAAGATCCCCCCCGACTCGGCC
GAGGAGGAGGTGGAAGAGTCGACGCCGGCGGAGCTGACCAACGGCCGCGGCAAACGGAATGGCAAGCGAGGAGAC
CTCCTCCGAGGCGTCCTCGACCCCGGCCGCAACGGCAGCAAGCCGCGCAGCCAGAAGGAGGACAGCGCGGCGTCG
GGGAGCAAGGAGACGACGCCCGACGTCGGATCGGCCAACGAAGAAGAGATGGCCGACGCGCCCGACGACGCGGCC
GCCACCGAGGTGTCCAACGAGCGGTGGATGCCGACGGTGCCCAAGCCGGTCGTCGTCGACGGCGACAACTCGCTC
CTCGACGCCGAGGGCGAGCTCAGGGCTGACGGCTTCTTCCGCCGCCCCTGGTACAACTTCTTTGCCAACCAGACC
ATCTTCGTGTTTTTCAGCATCTTCCAGACCATCTACAGCCGGCTCGTGGAGGTCAAGGGCAGTAAGGACATCGTC
TCGCGCGAGATCGACCGCCTCAGCCGGCCCAAGCCGGCCAGGGACATCGGATTCGCCGACACCGTCATGAACTAC
TTCGACCCCAGCGACGACTCGGACAAGTTCTGGCCGAAGACGGTGGAGCTCCTCGAGGACTACATCACAGGCGAG
CTCGAGGAGGCGCGGTACCAGGAAGTGCTGCGCCACTACTACCTGCGCAGCGGCTGGAAGCTCTACACCATCCAG
GACCAGCTCAAGACGCTGTGTCGTCTAGCGCTCACGTGCAGCAGCAACGACGCGAAGGAGAAGACGCCGGACCTG
ATCCACCAATACTTCGTGGGCCGCGAGAAGGACGAGACCAGCTATCAGACCGAGATCAGTGCGCGCAAGTTTGCC
GAGAAGTGTGTCAAGGACGGCGACATTTTTGTGATTTGCTGGTTCCCGCTCAAGGCCGAGGCCACGGTGCGCTGG
CTGCAGCGGAACGACACGACCTTCTACATGGACGAGATGCAGATGCGCGAGCGCTGGCAGTACTACATCTCGTCC
TTCATCCGGGTCGAGCCGACGGAGGGCATCCCGCGGTCCAAGCTGCAAAAGGTGGTGTTGACGCGCAACATGCCG
TCGGGCGACGGCGACTCGGACGAGGACAACGCGCCGAAGCCGCTGCTGTACAGTGAGAACCTGACGACGAGCATC
TGCCTCAAGAGCTCCAAGATGGTCTGGGCGCCCGGCACGTCCGAGTACTTCATCTACGACCAGGCGCCGCGGACG
GCCGAGGCCCGCGAGCGCGCCGACCGGATGCGCCTCGCCCTCGGCTGCGCGCGCGAGGGCCGCATGCTCGAGCGC
CTGGTGCAGAACCCGCCTTGGGCCAAGGAGCTGCCCGAGGACCGGGTGCGCGAGTACGTCGACGACTTTGAGCGC
TGGAAGCGCGAGGGCGTGCGGGCGGCGTCGGCCGATGGCGGCGGCGACACGGAGTGA
Gene >Hirsu2|9471
ATGAAAGACTTCAAGAGCCAGGCGTAAGTCTCTCCGCCGCCGACTCCATTTCCCTTGCCTTCCGGGTGACAGCCT
AACGTGTTTTTTTTTTCAGGATCGACACGCCAGGCGTGATCAACAGAGTGTCGGAGCTCTTTGCTGGACACCCCA
ATCTTATCCAGGGCTTCAACACCTTCCTCCCGCCTGGCTACAGGATTGAGTGCGGCGCTGGGAACGATCCCAACA
CCATACGGGTCACCACCCCGATGGGCACCACTGTCCAGTCGATTGCCGGGCGTGGAATCCAGAGCGATGGCCACG
GTCCCCCCGTTGCTGCCCAGCCCCCATTCCCCGAGCGCGGCGGCGGGCAGTGGCCGCAGAGACCTCAGCACGGCG
TCGAGAGCCCTGAAGCCAGCTTCAGCACTCCGGCGCAGAACGGCGCCACCCTCTTCGTTCAGGCTGCCGCGCAGA
ATGCCGCCTCCTTCGACGTCCCCGGCTCGCAGAGGAACGCGTCGCAGATGCCGGGCAACGCCGGCCCTGGCGGCG
CTCCGGCAGTACGCGGCGCTCAGACCCCAGCTCCCGGCGCCGGGCCGGGCGGCGTCAATGGCAGTCAAGCCAACA
TGGAGCGTAGGGGCCCCGTCGAGTTCAACCATGCCATCAGTTACGTCAACAAGATAAAGGTGGGTGCCCCCTTCC
TTTCCCCTCTGGCTCGCACTGCGAGACGTCCCTGGTTCTGACACCTTTCTCACGCGCGCAGAATCGTTTCCAGGA
CAAGCCAGAAATCTACAAGCAGTTCCTGGAGATCCTGCAGACGTATCAACGAGAACAGAAGCCGATTCAGGACGT
TTACGCTCAGGTCACGACCCTCTTCAACTCGGCCCCGGATCTCCTGGAGGATTTCAAGCAGTTCCTTCCAGAGTC
GGCCGGCCAGGCCAAGGCAGCCCAAGCAAGGCTGGAGGACGGGGTGCCGCCGGGTCCGAGTCATACCCCGCAGCC
GGGCATGCGTGATGGCCAGAAGATGCCTCCTCTGGGGAGCTTCGCCCCGCCTGCGAGCGCGAGCAAAGATAAGAA
ACGGCCACGCACCGACAAGCAGGCCCAAGGCGCCGAGGCGCTGCTGGCCGAAACGGTGGCGACCGGCCGTCTTCA
GCCGTCCATCGTGAATGGCAACAAGCGGCCCAAGCTGAGCCATGCCAGGGGCGCTGGCGATGCCGCGGCCCCGAT
CGAGCCCACGCTCACGCCCGTCATGCCCGAGCCGTATCAGCCACGCGCCTCGGCGACCTCGAACCAAGAGGAGAT
TGCCTTTTTCGAACGCGTCAAGAAGTTCCTGAGCAACAGGTCTTCCATGAACGACTTTCTCAAACTATGCAACCT
ATTCAGCCAGAACATCATCGATCGAAACACACTCTTCCACAAGGGCGCCCTGTTCATCGGTGCGAACCCGGATCT
CATGAGTTTCTGGAAGACATTCGTCGGCGTCGACTCGCAGGATGTCATAGTGGACAACCGTCCCGCGCCGCCCAC
GGAGAAGCTATCGCTGAGCAACTGTCGGGGTTACGGACCCAGCTACAGGCTGCTGCCCAAACGGGTAAGTAATGA
TCAGATCCCAGGCGTCACCCTCGTCGTCGTGCCAGTCCCGCTGACCTGGGCCCTTTAGGAGCGCCTCAAGCCGTG
CAGCGGACGCGATGAGCTGTGCAACTCGGTCCTGAACGATCAGTGGGCATCTCATCCCACCTGGGCCAGCGAGGA
TTCCGGATTCGTGGCGCACCGGAAGAACCAGTTCGAGGAAGGCCTGCACCGCATCGAGGAGGAGCGCCACGACTA
CGATTTCAACATCGAGATCAACCTCAAGTGCATCCAGCTGCTCGAACCCGTCGCGCAGCAGATGCTGGCCATGTC
TCCGGTCGAGAGGGAGACGTTCCACATGCCGGCCGCCCTGGCAGGCCAGAGCACCTCCATCTTCAAGCGCATCTG
CAAGAAGATCTACGGGGACAGGGGCATCGACGTCGTCAACGACATGTTCAGCCACCCGTTCGACGTGGTGCCCGT
CCTGCTCACGCGCATGAAGCAGAAGGATGAGGAGTGGCGCTTCTCCCAGCGCGAGTGGGAGAAGGTGTGGCACGC
GCAGACGGAGCACATGTACCTCAAGAGCCTCGACCACATGGGCATACTGGTCAAGAGCAACGACAAGAGGAACCT
GACGGCCAAGCACCTCGTCGACGTCATCAAGACCAAGCACGAGGAACAGCGACGGGAGCGCGCCCTCAAGGGCAA
GGCGCCGCGCTACCAGCTCGTCTGGGACTTTGGCGACAAGGACGTCATCCTCGACCTGCTGCGCCTGATGATGCT
CTATCCCCTCCACAGCGGCCAGCATAGCGCGCAGGAAAAGGAGAGGCTCTTGGAGTTCTTCGAGTCGTTCGTCGC
TACCTTCTTCGACCTCAACGAGGAGGTGGTGCAGGAGCGGGTGCCTAAGATCCCCCCCGACTCGGCCGAGGAGGA
GGTGGAAGAGTCGACGCCGGCGGAGCTGACCAACGGCCGCGGCAAACGGAATGGCAAGCGAGGAGACCTCCTCCG
AGGCGTCCTCGACCCCGGCCGCAACGGCAGCAAGCCGCGCAGCCAGAAGGAGGACAGCGCGGCGTCGGGGAGCAA
GGAGACGACGCCCGACGTCGGATCGGCCAACGAAGAAGAGATGGCCGACGCGCCCGACGACGCGGCCGCCACCGA
GGTGTCCAACGAGCGGTGGATGCCGACGGTGCCCAAGCCGGTCGTCGTCGACGGCGACAACTCGCTCCTCGACGC
CGAGGGCGAGCTCAGGGCTGACGGCTTCTTCCGCCGCCCCTGGTACAACTTCTTTGCCAACCAGACCATCTTCGT
GTTTTTCAGCATCTTCCAGACCATCTACAGCCGGCTCGTGGAGGTCAAGGGCAGTAAGGACATCGTCTCGCGCGA
GATCGACCGCCTCAGCCGGCCCAAGCCGGCCAGGGACATCGGATTCGCCGACACCGTCATGAACTACTTCGACCC
CAGCGACGACTCGGACAAGTTCTGGCCGAAGACGGTGGAGCTCCTCGAGGACTACATCACAGGCGAGCTCGAGGA
GGCGCGGTACCAGGAAGTGCTGCGCCACTACTACCTGCGCAGCGGCTGGAAGCTCTACACCATCCAGGACCAGCT
CAAGACGCTGTGTCGTCTAGCGCTCACGTGCAGCAGCAACGACGCGAAGGAGAAGACGCCGGACCTGATCCACCA
ATACTTCGTGGGCCGCGAGAAGGACGAGACCAGCTATCAGACCGAGATCAGTGCGCGCAAGTTTGCCGAGAAGTG
TGTCAAGGACGGCGACATTTTTGTGATTTGCTGGGTAAGTCAACACCCCCTCCCCCCCCTCCGAGCCCCCACGGG
TTGTAGGAGAAGGGAAGAGAGGTATGCTGACCGCTGCGGCAACAGTTCCCGCTCAAGGCCGAGGCCACGGTGCGC
TGGCTGCAGCGGAACGACACGACCTTCTACATGGACGAGATGCAGATGCGCGAGCGCTGGCAGTACTACATCTCG
TCCTTCATCCGGGTCGAGCCGACGGAGGGCATCCCGCGGTCCAAGCTGCAAAAGGTGGTGTTGACGCGCAACATG
CCGTCGGGCGACGGCGACTCGGACGAGGACAACGCGCCGAAGCCGCTGCTGTACAGTGAGAACCTGACGACGAGC
ATCTGCCTCAAGAGCTCCAAGATGGTCTGGGCGCCCGGCACGTCCGAGTACTTCATCTACGACCAGGCGCCGCGG
ACGGCCGAGGCCCGCGAGCGCGCCGACCGGATGCGCCTCGCCCTCGGCTGCGCGCGCGAGGGCCGCATGCTCGAG
CGCCTGGTGCAGAACCCGCCTTGGGCCAAGGAGCTGCCCGAGGACCGGGTGCGCGAGTACGTCGACGACTTTGAG
CGCTGGAAGCGCGAGGGCGTGCGGGCGGCGTCGGCCGATGGCGGCGGCGACACGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail