Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|947
Gene name
LocationContig_12:6890..7264
Strand-
Gene length (bp)374
Transcript length (bp)315
Coding sequence length (bp)315
Protein length (aa) 105

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0772 0.0428 0.9724 0.0417 0.0796 0.0073 0.0483 0.1124 0.0532 0.0106

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.99977

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5753
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06019
Ophiocordyceps camponoti-rufipedis Ophun1|6640
Ophiocordyceps kimflemingae Ophio5|6304
Ophiocordyceps subramaniannii Hirsu2|9275
Ophiocordyceps subramaniannii Hirsu2|947 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|947
MLALQFIVLAFSVALAAPSKDRSSHDMDKKDRTYGDVCGDKDAYCCDSREAGSGGSPPAGLGSCNPVPIVGIPIR
GSCGGKVCCSGEQEQEGGLVNIQCVNVGL*
Coding >Hirsu2|947
ATGCTCGCCCTCCAGTTCATCGTCCTAGCCTTCTCGGTCGCCCTAGCAGCCCCTTCCAAGGACCGATCTTCCCAC
GACATGGACAAGAAAGATCGGACATATGGTGACGTCTGCGGGGACAAGGACGCCTACTGCTGCGATAGCCGCGAA
GCAGGTTCTGGCGGCTCGCCTCCTGCCGGCTTGGGCTCCTGCAATCCAGTGCCCATTGTCGGCATCCCGATTCGA
GGGTCCTGCGGGGGAAAGGTTTGCTGCTCTGGCGAGCAAGAGCAAGAGGGGGGGCTTGTGAACATTCAATGCGTC
AATGTCGGGCTCTGA
Transcript >Hirsu2|947
ATGCTCGCCCTCCAGTTCATCGTCCTAGCCTTCTCGGTCGCCCTAGCAGCCCCTTCCAAGGACCGATCTTCCCAC
GACATGGACAAGAAAGATCGGACATATGGTGACGTCTGCGGGGACAAGGACGCCTACTGCTGCGATAGCCGCGAA
GCAGGTTCTGGCGGCTCGCCTCCTGCCGGCTTGGGCTCCTGCAATCCAGTGCCCATTGTCGGCATCCCGATTCGA
GGGTCCTGCGGGGGAAAGGTTTGCTGCTCTGGCGAGCAAGAGCAAGAGGGGGGGCTTGTGAACATTCAATGCGTC
AATGTCGGGCTCTGA
Gene >Hirsu2|947
ATGCTCGCCCTCCAGTTCATCGTCCTAGCCTTCTCGGTCGCCCTAGCAGCCCCTTCCAAGGACCGATCTTCCCAC
GACATGGACAAGAAAGATCGGACATATGGTGACGTCTGCGGGGACAAGGACGCCTACTGCTGCGATAGCCGCGAA
GCAGGTTCTGGCGGCTCGCCTCCTGCCGGCTTGGGCTCCTGCAATCCAGTGCCCATTGTCGGCATCCCGATTCGA
GGGTCCTGCGGGGGAAAGGTTTGCTGCTCTGGCGAGCAAGAGCAAGAGGTAAGTACCGCATCTTATTCACACCGC
GGGATGGTTTCTCTGGCTAACAATATCCAAAGGGGGGGCTTGTGAACATTCAATGCGTCAATGTCGGGCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail