Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9465
Gene name
LocationContig_691:5330..7543
Strand+
Gene length (bp)2213
Transcript length (bp)2007
Coding sequence length (bp)2007
Protein length (aa) 669

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08740 BCS1_N BCS1 N terminal 3.6E-42 85 287
PF00004 AAA ATPase family associated with various cellular activities (AAA) 8.8E-09 325 395
PF00004 AAA ATPase family associated with various cellular activities (AAA) 5.2E-06 473 525

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DY9|BCS1B_DICDI Probable mitochondrial chaperone BCS1-B OS=Dictyostelium discoideum GN=bcsl1b PE=3 SV=1 78 544 2.0E-50
sp|P32839|BCS1_YEAST Mitochondrial chaperone BCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCS1 PE=1 SV=2 170 391 5.0E-29
sp|Q5E9H5|BCS1_BOVIN Mitochondrial chaperone BCS1 OS=Bos taurus GN=BCS1L PE=2 SV=1 78 390 1.0E-27
sp|Q9P6Q3|BCS1_SCHPO Probable mitochondrial chaperone bcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.07 PE=2 SV=1 187 391 2.0E-27
sp|Q7ZV60|BCS1_DANRE Mitochondrial chaperone BCS1 OS=Danio rerio GN=bcs1l PE=2 SV=2 78 390 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54DY9|BCS1B_DICDI Probable mitochondrial chaperone BCS1-B OS=Dictyostelium discoideum GN=bcsl1b PE=3 SV=1 78 544 2.0E-50
sp|P32839|BCS1_YEAST Mitochondrial chaperone BCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCS1 PE=1 SV=2 170 391 5.0E-29
sp|Q5E9H5|BCS1_BOVIN Mitochondrial chaperone BCS1 OS=Bos taurus GN=BCS1L PE=2 SV=1 78 390 1.0E-27
sp|Q9P6Q3|BCS1_SCHPO Probable mitochondrial chaperone bcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.07 PE=2 SV=1 187 391 2.0E-27
sp|Q7ZV60|BCS1_DANRE Mitochondrial chaperone BCS1 OS=Danio rerio GN=bcs1l PE=2 SV=2 78 390 4.0E-27
sp|Q9Y276|BCS1_HUMAN Mitochondrial chaperone BCS1 OS=Homo sapiens GN=BCS1L PE=1 SV=1 78 390 4.0E-27
sp|Q7ZTL7|BCS1_XENLA Mitochondrial chaperone BCS1 OS=Xenopus laevis GN=bcs1l PE=2 SV=1 78 390 6.0E-27
sp|Q9CZP5|BCS1_MOUSE Mitochondrial chaperone BCS1 OS=Mus musculus GN=Bcs1l PE=1 SV=1 78 390 7.0E-27
sp|Q54HY8|BCS1A_DICDI Probable mitochondrial chaperone BCS1-A OS=Dictyostelium discoideum GN=bcs1la PE=3 SV=1 66 385 1.0E-25
sp|Q9FKM3|AATPK_ARATH AAA-ATPase At5g57480 OS=Arabidopsis thaliana GN=At5g57480 PE=3 SV=1 273 600 4.0E-20
sp|F4J0C0|AATPA_ARATH AAA-ATPase At3g28600 OS=Arabidopsis thaliana GN=At3g28600 PE=2 SV=1 221 541 1.0E-18
sp|Q9LJJ5|AATPB_ARATH AAA-ATPase At3g28610 OS=Arabidopsis thaliana GN=At3g28610 PE=2 SV=1 221 526 7.0E-18
sp|Q54HY8|BCS1A_DICDI Probable mitochondrial chaperone BCS1-A OS=Dictyostelium discoideum GN=bcs1la PE=3 SV=1 479 543 2.0E-16
sp|Q5UR45|YL572_MIMIV Putative AAA family ATPase L572 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L572 PE=3 SV=1 471 542 1.0E-13
sp|Q9FN78|AATPF_ARATH AAA-ATPase At5g17730 OS=Arabidopsis thaliana GN=At5g17730 PE=3 SV=1 273 404 1.0E-13
sp|Q5E9H5|BCS1_BOVIN Mitochondrial chaperone BCS1 OS=Bos taurus GN=BCS1L PE=2 SV=1 469 541 2.0E-13
sp|F4JPK8|AATPE_ARATH AAA-ATPase At4g30250 OS=Arabidopsis thaliana GN=At4g30250 PE=3 SV=1 273 385 2.0E-13
sp|Q9P6Q3|BCS1_SCHPO Probable mitochondrial chaperone bcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.07 PE=2 SV=1 466 545 1.0E-12
sp|Q7ZTL7|BCS1_XENLA Mitochondrial chaperone BCS1 OS=Xenopus laevis GN=bcs1l PE=2 SV=1 466 541 2.0E-12
sp|Q7ZV60|BCS1_DANRE Mitochondrial chaperone BCS1 OS=Danio rerio GN=bcs1l PE=2 SV=2 479 547 3.0E-12
sp|Q9Y276|BCS1_HUMAN Mitochondrial chaperone BCS1 OS=Homo sapiens GN=BCS1L PE=1 SV=1 469 541 6.0E-12
sp|Q9CZP5|BCS1_MOUSE Mitochondrial chaperone BCS1 OS=Mus musculus GN=Bcs1l PE=1 SV=1 469 541 6.0E-12
sp|Q8RY66|AATPD_ARATH AAA-ATPase At4g25835 OS=Arabidopsis thaliana GN=At4g25835 PE=2 SV=1 273 385 1.0E-11
sp|F4KFX5|AATPJ_ARATH AAA-ATPase At5g40000 OS=Arabidopsis thaliana GN=At5g40000 PE=3 SV=1 236 386 1.0E-11
sp|Q9FN75|AATPI_ARATH AAA-ATPase At5g17760 OS=Arabidopsis thaliana GN=At5g17760 PE=2 SV=1 269 385 4.0E-11
sp|Q8VZG2|HSR4_ARATH Protein HYPER-SENSITIVITY-RELATED 4 OS=Arabidopsis thaliana GN=HSR4 PE=2 SV=1 273 402 1.0E-10
sp|Q147F9|AATPC_ARATH AAA-ATPase At3g50940 OS=Arabidopsis thaliana GN=At3g50940 PE=2 SV=1 270 391 1.0E-10
sp|Q9FN77|AATPG_ARATH AAA-ATPase At5g17740 OS=Arabidopsis thaliana GN=At5g17740 PE=3 SV=1 273 385 2.0E-10
sp|P32839|BCS1_YEAST Mitochondrial chaperone BCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCS1 PE=1 SV=2 469 541 4.0E-10
sp|Q8GW96|AATP3_ARATH AAA-ATPase At2g18193 OS=Arabidopsis thaliana GN=At2g18193 PE=2 SV=1 286 405 4.0E-10
sp|Q9FLD5|ASD_ARATH AAA-ATPase ASD, mitochondrial OS=Arabidopsis thaliana GN=AATP1 PE=1 SV=1 118 385 9.0E-10
sp|F4IQG2|AATP2_ARATH AAA-ATPase At2g18190 OS=Arabidopsis thaliana GN=At2g18190 PE=2 SV=1 286 395 2.0E-09
sp|F4KFX5|AATPJ_ARATH AAA-ATPase At5g40000 OS=Arabidopsis thaliana GN=At5g40000 PE=3 SV=1 470 526 4.0E-09
sp|F4KID5|AATPH_ARATH AAA-ATPase At5g17750 OS=Arabidopsis thaliana GN=At5g17750 PE=3 SV=1 237 385 4.0E-09
sp|Q9FN77|AATPG_ARATH AAA-ATPase At5g17740 OS=Arabidopsis thaliana GN=At5g17740 PE=3 SV=1 477 529 5.0E-09
sp|Q9LJJ7|AATP9_ARATH AAA-ATPase At3g28580 OS=Arabidopsis thaliana GN=At3g28580 PE=2 SV=1 69 385 5.0E-09
sp|F4KID5|AATPH_ARATH AAA-ATPase At5g17750 OS=Arabidopsis thaliana GN=At5g17750 PE=3 SV=1 461 529 5.0E-09
sp|Q9LH84|AATP5_ARATH AAA-ATPase At3g28510 OS=Arabidopsis thaliana GN=At3g28510 PE=2 SV=1 273 385 8.0E-09
sp|Q9LP11|AATP1_ARATH AAA-ATPase At1g43910 OS=Arabidopsis thaliana GN=At1g43910 PE=1 SV=1 471 529 9.0E-09
sp|F4J0B7|AATP8_ARATH AAA-ATPase At3g28570, mitochondrial OS=Arabidopsis thaliana GN=At3g28570 PE=3 SV=1 470 529 1.0E-08
sp|Q9LH83|AATP6_ARATH AAA-ATPase At3g28520 OS=Arabidopsis thaliana GN=At3g28520 PE=3 SV=1 474 578 1.0E-08
sp|Q8VZG2|HSR4_ARATH Protein HYPER-SENSITIVITY-RELATED 4 OS=Arabidopsis thaliana GN=HSR4 PE=2 SV=1 477 526 1.0E-08
sp|Q9LH82|AATP7_ARATH AAA-ATPase At3g28540 OS=Arabidopsis thaliana GN=At3g28540 PE=2 SV=1 224 385 2.0E-08
sp|Q9FN75|AATPI_ARATH AAA-ATPase At5g17760 OS=Arabidopsis thaliana GN=At5g17760 PE=2 SV=1 468 529 2.0E-08
sp|F4IJ77|AATP4_ARATH AAA-ATPase At2g46620 OS=Arabidopsis thaliana GN=At2g46620 PE=2 SV=1 262 383 2.0E-08
sp|Q8RY66|AATPD_ARATH AAA-ATPase At4g25835 OS=Arabidopsis thaliana GN=At4g25835 PE=2 SV=1 476 597 2.0E-08
sp|Q147F9|AATPC_ARATH AAA-ATPase At3g50940 OS=Arabidopsis thaliana GN=At3g50940 PE=2 SV=1 477 526 3.0E-08
sp|Q9LH83|AATP6_ARATH AAA-ATPase At3g28520 OS=Arabidopsis thaliana GN=At3g28520 PE=3 SV=1 272 385 4.0E-08
sp|Q8GW96|AATP3_ARATH AAA-ATPase At2g18193 OS=Arabidopsis thaliana GN=At2g18193 PE=2 SV=1 479 544 6.0E-08
sp|F4J0B7|AATP8_ARATH AAA-ATPase At3g28570, mitochondrial OS=Arabidopsis thaliana GN=At3g28570 PE=3 SV=1 272 411 6.0E-08
sp|F4IQG2|AATP2_ARATH AAA-ATPase At2g18190 OS=Arabidopsis thaliana GN=At2g18190 PE=2 SV=1 479 543 7.0E-08
sp|Q9FLD5|ASD_ARATH AAA-ATPase ASD, mitochondrial OS=Arabidopsis thaliana GN=AATP1 PE=1 SV=1 473 526 2.0E-07
sp|F4JPK8|AATPE_ARATH AAA-ATPase At4g30250 OS=Arabidopsis thaliana GN=At4g30250 PE=3 SV=1 464 541 2.0E-07
sp|Q9FN78|AATPF_ARATH AAA-ATPase At5g17730 OS=Arabidopsis thaliana GN=At5g17730 PE=3 SV=1 475 529 4.0E-07
sp|Q5UPR4|YR776_MIMIV Uncharacterized protein R776 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R776 PE=4 SV=1 280 383 5.0E-07
sp|D3FFN2|FTSH_MYCGH ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma gallisepticum (strain R(high / passage 156)) GN=ftsH PE=3 SV=1 292 393 6.0E-07
sp|B3DY14|FTSH2_METI4 ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1 480 541 7.0E-07
sp|Q9LH82|AATP7_ARATH AAA-ATPase At3g28540 OS=Arabidopsis thaliana GN=At3g28540 PE=2 SV=1 479 541 9.0E-07
sp|D1BLD0|FTSH_VEIPT ATP-dependent zinc metalloprotease FtsH OS=Veillonella parvula (strain ATCC 10790 / DSM 2008 / JCM 12972 / Te3) GN=ftsH PE=3 SV=1 288 389 1.0E-06
sp|Q9LJJ7|AATP9_ARATH AAA-ATPase At3g28580 OS=Arabidopsis thaliana GN=At3g28580 PE=2 SV=1 473 526 2.0E-06
sp|Q9LP11|AATP1_ARATH AAA-ATPase At1g43910 OS=Arabidopsis thaliana GN=At1g43910 PE=1 SV=1 273 383 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0034551 mitochondrial respiratory chain complex III assembly Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0017062 respiratory chain complex III assembly No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0033108 mitochondrial respiratory chain complex assembly No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0065003 protein-containing complex assembly No
GO:0034622 cellular protein-containing complex assembly No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017004 cytochrome complex assembly No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0022607 cellular component assembly No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0071840 cellular component organization or biogenesis No
GO:0016043 cellular component organization No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043933 protein-containing complex subunit organization No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9465
MGLQPVALQANNGSAGLNGSSSSSSSSSSSSSSSSAFPPGMVDSFLLGAGQASPLMQLVLFLYRQLGLQLGLDPS
LLLTGLGLVWGLFRMGAQVYELVRGLFDRFFRCTMYVSEHDIIYDHLMKWLSLQDATSNSRALMAESVYRSAWDE
EDDLGGAVSWTSIDDGDGECHYLNFSSLAMRTKPRYVPARGSTSFWHRGTYIYVTRRRETLTGSYGLQSKYEELF
ISCHGRSMEPIKQLLFEAKALYNEDTSRKTTIYRPRSKQQRQDGSTLWQQVARRPIRPMPTVVLDSKEKRRVLAD
LNEYLDPATAGWYARRGIPLRRGYLLHGPPGTGKTSFSFALAGIFGIDIYVISLQDASITEEDLASLFTKLPRRC
IVLLEDIDSAGLRRDKHDADKAKDGDNGKAGRKRSSRNKAATKVNGNKASPKPDDDDDDGSSSSSDSDSDSDSEQ
ACPPSPAPKDKAKPGSKANGKKKNGGKGITLSGLLNAIDGVASQEGRTLIATTNKLETLDEALIRPGRMDMHVRF
ANASRLQATELFLRMYGLDPAAGGADGGGGGQLSPRKTRPGSDEAEAEDAARRKMHKRQQQQQQDRRREVDFGQL
DVASAGELKRCARAFGDRIPDGVFSPAELQGFLLKRKKGPCRAADEVSAWAEALLRQKEANSKAVTVQ*
Coding >Hirsu2|9465
ATGGGCCTCCAACCGGTGGCGCTGCAGGCCAACAACGGCTCTGCCGGCCTCAACGGCTCGTCGTCGTCATCGTCA
TCGTCGTCATCGTCGTCGTCGTCGTCGTCGGCCTTCCCACCAGGCATGGTGGATAGCTTCCTGCTTGGCGCGGGC
CAGGCCTCGCCGCTCATGCAGCTCGTCCTCTTCCTCTACCGCCAGCTCGGCCTGCAGCTCGGCCTCGACCCGTCG
CTGCTGCTGACCGGGCTCGGCCTCGTCTGGGGTCTGTTCCGGATGGGCGCCCAGGTGTACGAGCTCGTGCGCGGC
CTCTTCGACCGCTTCTTCCGCTGCACCATGTACGTGTCGGAGCACGACATCATCTACGACCACCTGATGAAGTGG
CTGTCGCTGCAGGACGCCACCAGCAACAGCCGCGCCCTCATGGCCGAGAGCGTCTACCGCAGCGCCTGGGACGAG
GAGGACGACCTCGGCGGCGCCGTCTCGTGGACCAGCATCGACGACGGCGACGGCGAGTGCCACTATCTCAACTTT
TCCAGCCTCGCCATGCGCACGAAGCCGAGATACGTCCCGGCCAGGGGCAGCACCAGCTTCTGGCACCGCGGGACC
TACATCTACGTCACGCGCAGGAGGGAGACGCTCACCGGCAGCTACGGTCTCCAGTCCAAGTACGAGGAGCTCTTC
ATCTCGTGCCACGGCCGCTCCATGGAACCAATCAAGCAGCTCCTTTTCGAGGCCAAGGCCCTGTACAACGAGGAC
ACGTCGCGCAAGACGACCATCTACCGCCCGCGGTCCAAACAGCAGCGCCAGGACGGCAGCACGCTGTGGCAGCAG
GTGGCGCGGCGGCCGATCCGACCGATGCCGACCGTCGTGCTCGACTCCAAGGAGAAGCGCCGGGTGCTGGCCGAC
CTCAACGAGTACCTGGACCCGGCCACGGCCGGCTGGTACGCCCGCCGCGGCATCCCGCTGCGCCGCGGCTACCTG
CTGCACGGCCCGCCCGGCACGGGCAAGACGAGCTTCTCCTTCGCGCTCGCCGGCATCTTCGGCATCGACATCTAC
GTCATCAGCCTGCAGGACGCCAGCATCACCGAGGAGGACCTGGCCTCGCTCTTCACCAAGCTTCCGCGCCGCTGC
ATCGTACTCCTCGAGGACATCGACTCGGCCGGCCTGCGGCGCGACAAGCACGACGCGGACAAGGCCAAGGATGGC
GACAACGGCAAGGCGGGCCGGAAGCGCAGCTCGCGGAACAAGGCGGCGACCAAGGTCAACGGCAACAAGGCATCG
CCGAAGCCGGATGACGATGACGACGACGGCAGCAGCAGCAGCAGTGACTCCGACTCCGACTCCGACTCCGAGCAG
GCGTGCCCCCCGTCCCCCGCCCCCAAGGACAAGGCAAAGCCGGGCAGCAAGGCCAACGGCAAGAAGAAGAACGGC
GGCAAGGGCATCACGCTGTCCGGCCTGCTCAACGCCATCGACGGCGTGGCCTCGCAGGAGGGCCGCACGCTGATC
GCGACGACCAACAAGCTCGAGACGCTGGACGAGGCCCTCATCCGGCCGGGCCGCATGGACATGCACGTCCGCTTC
GCCAACGCCTCCCGGCTGCAGGCGACCGAGCTCTTCCTGCGCATGTACGGGCTCGACCCGGCGGCGGGCGGCGCC
GACGGCGGCGGCGGCGGCCAGCTCTCGCCGCGCAAGACGCGGCCCGGCAGCGACGAGGCCGAGGCCGAGGACGCG
GCGAGGAGGAAGATGCACAAGAGGCAGCAGCAGCAGCAGCAGGACAGGCGGCGCGAGGTCGACTTCGGCCAGCTC
GACGTGGCCTCGGCCGGGGAGCTGAAGCGGTGCGCGCGCGCGTTCGGCGACCGCATCCCGGACGGCGTCTTCTCG
CCCGCCGAGCTGCAGGGCTTCCTGCTCAAGCGCAAGAAGGGCCCGTGCCGGGCGGCTGACGAGGTGAGCGCTTGG
GCTGAGGCGCTGCTGCGGCAGAAGGAGGCCAACTCCAAGGCCGTGACGGTGCAGTGA
Transcript >Hirsu2|9465
ATGGGCCTCCAACCGGTGGCGCTGCAGGCCAACAACGGCTCTGCCGGCCTCAACGGCTCGTCGTCGTCATCGTCA
TCGTCGTCATCGTCGTCGTCGTCGTCGTCGGCCTTCCCACCAGGCATGGTGGATAGCTTCCTGCTTGGCGCGGGC
CAGGCCTCGCCGCTCATGCAGCTCGTCCTCTTCCTCTACCGCCAGCTCGGCCTGCAGCTCGGCCTCGACCCGTCG
CTGCTGCTGACCGGGCTCGGCCTCGTCTGGGGTCTGTTCCGGATGGGCGCCCAGGTGTACGAGCTCGTGCGCGGC
CTCTTCGACCGCTTCTTCCGCTGCACCATGTACGTGTCGGAGCACGACATCATCTACGACCACCTGATGAAGTGG
CTGTCGCTGCAGGACGCCACCAGCAACAGCCGCGCCCTCATGGCCGAGAGCGTCTACCGCAGCGCCTGGGACGAG
GAGGACGACCTCGGCGGCGCCGTCTCGTGGACCAGCATCGACGACGGCGACGGCGAGTGCCACTATCTCAACTTT
TCCAGCCTCGCCATGCGCACGAAGCCGAGATACGTCCCGGCCAGGGGCAGCACCAGCTTCTGGCACCGCGGGACC
TACATCTACGTCACGCGCAGGAGGGAGACGCTCACCGGCAGCTACGGTCTCCAGTCCAAGTACGAGGAGCTCTTC
ATCTCGTGCCACGGCCGCTCCATGGAACCAATCAAGCAGCTCCTTTTCGAGGCCAAGGCCCTGTACAACGAGGAC
ACGTCGCGCAAGACGACCATCTACCGCCCGCGGTCCAAACAGCAGCGCCAGGACGGCAGCACGCTGTGGCAGCAG
GTGGCGCGGCGGCCGATCCGACCGATGCCGACCGTCGTGCTCGACTCCAAGGAGAAGCGCCGGGTGCTGGCCGAC
CTCAACGAGTACCTGGACCCGGCCACGGCCGGCTGGTACGCCCGCCGCGGCATCCCGCTGCGCCGCGGCTACCTG
CTGCACGGCCCGCCCGGCACGGGCAAGACGAGCTTCTCCTTCGCGCTCGCCGGCATCTTCGGCATCGACATCTAC
GTCATCAGCCTGCAGGACGCCAGCATCACCGAGGAGGACCTGGCCTCGCTCTTCACCAAGCTTCCGCGCCGCTGC
ATCGTACTCCTCGAGGACATCGACTCGGCCGGCCTGCGGCGCGACAAGCACGACGCGGACAAGGCCAAGGATGGC
GACAACGGCAAGGCGGGCCGGAAGCGCAGCTCGCGGAACAAGGCGGCGACCAAGGTCAACGGCAACAAGGCATCG
CCGAAGCCGGATGACGATGACGACGACGGCAGCAGCAGCAGCAGTGACTCCGACTCCGACTCCGACTCCGAGCAG
GCGTGCCCCCCGTCCCCCGCCCCCAAGGACAAGGCAAAGCCGGGCAGCAAGGCCAACGGCAAGAAGAAGAACGGC
GGCAAGGGCATCACGCTGTCCGGCCTGCTCAACGCCATCGACGGCGTGGCCTCGCAGGAGGGCCGCACGCTGATC
GCGACGACCAACAAGCTCGAGACGCTGGACGAGGCCCTCATCCGGCCGGGCCGCATGGACATGCACGTCCGCTTC
GCCAACGCCTCCCGGCTGCAGGCGACCGAGCTCTTCCTGCGCATGTACGGGCTCGACCCGGCGGCGGGCGGCGCC
GACGGCGGCGGCGGCGGCCAGCTCTCGCCGCGCAAGACGCGGCCCGGCAGCGACGAGGCCGAGGCCGAGGACGCG
GCGAGGAGGAAGATGCACAAGAGGCAGCAGCAGCAGCAGCAGGACAGGCGGCGCGAGGTCGACTTCGGCCAGCTC
GACGTGGCCTCGGCCGGGGAGCTGAAGCGGTGCGCGCGCGCGTTCGGCGACCGCATCCCGGACGGCGTCTTCTCG
CCCGCCGAGCTGCAGGGCTTCCTGCTCAAGCGCAAGAAGGGCCCGTGCCGGGCGGCTGACGAGGTGAGCGCTTGG
GCTGAGGCGCTGCTGCGGCAGAAGGAGGCCAACTCCAAGGCCGTGACGGTGCAGTGA
Gene >Hirsu2|9465
ATGGGCCTCCAACCGGTGGCGCTGCAGGCCAACAACGGCTCTGCCGGCCTCAACGGCTCGTCGTCGTCATCGTCA
TCGTCGTCATCGTCGTCGTCGTCGTCGTCGGCCTTCCCACCAGGCATGGTGGATAGCTTCCTGCTTGGCGCGGGC
CAGGCCTCGCCGCTCATGCAGCTCGTCCTCTTCCTCTACCGCCAGCTCGGCCTGCAGCTCGGCCTCGACCCGTCG
CTGCTGCTGACCGGGCTCGGCCTCGTCTGGGGTCTGTTCCGGATGGGCGCCCAGGTGTACGAGCTCGTGCGCGGC
CTCTTCGACCGCTTCTTCCGCTGCACCATGTACGTGTCGGAGCACGACATCATCTACGACCACCTGATGAAGTGG
CTGTCGCTGCAGGACGCCACCAGCAACAGCCGCGCCCTCATGGCCGAGAGCGTCTACCGCAGCGCCTGGGACGAG
GAGGACGACCTCGGCGGCGCCGTCTCGTGGACCAGCATCGACGACGGCGACGGCGAGTGCCACTATCTCAACTTT
TCCAGCCTCGCCATGCGCACGGTTCGCCCCCCCTCCCCCCTTTCCATCTCCTTGCCTTGAGTCGGGAAGAGAGGA
CGGCACGGCTAACGAGTTGCTTGCTTGCTTGCCAGAAGCCGAGATACGTCCCGGCCAGGGGCAGCACCAGCTTCT
GGCACCGCGGGACCTACATCTACGTCACGCGCAGGAGGGAGACGCTCACCGGCAGCTACGGTCTCCAGTCCAAGT
ACGAGGAGCTCTTCATCTCGTGCCACGGCCGCTCCATGGGTAGGTGAAGCACGATACCCCCCAAAAAGGCACCTG
GGTGGCGAGGAAGAAGAGCTCTCTTCTCCGATCCGGGTGCTCCGTCTTCAACTCGCTGACATTCGGGATGACCTG
TGGCAGAACCAATCAAGCAGCTCCTTTTCGAGGCCAAGGCCCTGTACAACGAGGACACGTCGCGCAAGACGACCA
TCTACCGCCCGCGGTCCAAACAGCAGCGCCAGGACGGCAGCACGCTGTGGCAGCAGGTGGCGCGGCGGCCGATCC
GACCGATGCCGACCGTCGTGCTCGACTCCAAGGAGAAGCGCCGGGTGCTGGCCGACCTCAACGAGTACCTGGACC
CGGCCACGGCCGGCTGGTACGCCCGCCGCGGCATCCCGCTGCGCCGCGGCTACCTGCTGCACGGCCCGCCCGGCA
CGGGCAAGACGAGCTTCTCCTTCGCGCTCGCCGGCATCTTCGGCATCGACATCTACGTCATCAGCCTGCAGGACG
CCAGCATCACCGAGGAGGACCTGGCCTCGCTCTTCACCAAGCTTCCGCGCCGCTGCATCGTACTCCTCGAGGACA
TCGACTCGGCCGGCCTGCGGCGCGACAAGCACGACGCGGACAAGGCCAAGGATGGCGACAACGGCAAGGCGGGCC
GGAAGCGCAGCTCGCGGAACAAGGCGGCGACCAAGGTCAACGGCAACAAGGCATCGCCGAAGCCGGATGACGATG
ACGACGACGGCAGCAGCAGCAGCAGTGACTCCGACTCCGACTCCGACTCCGAGCAGGCGTGCCCCCCGTCCCCCG
CCCCCAAGGACAAGGCAAAGCCGGGCAGCAAGGCCAACGGCAAGAAGAAGAACGGCGGCAAGGGCATCACGCTGT
CCGGCCTGCTCAACGCCATCGACGGCGTGGCCTCGCAGGAGGGCCGCACGCTGATCGCGACGACCAACAAGCTCG
AGACGCTGGACGAGGCCCTCATCCGGCCGGGCCGCATGGACATGCACGTCCGCTTCGCCAACGCCTCCCGGCTGC
AGGCGACCGAGCTCTTCCTGCGCATGTACGGGCTCGACCCGGCGGCGGGCGGCGCCGACGGCGGCGGCGGCGGCC
AGCTCTCGCCGCGCAAGACGCGGCCCGGCAGCGACGAGGCCGAGGCCGAGGACGCGGCGAGGAGGAAGATGCACA
AGAGGCAGCAGCAGCAGCAGCAGGACAGGCGGCGCGAGGTCGACTTCGGCCAGCTCGACGTGGCCTCGGCCGGGG
AGCTGAAGCGGTGCGCGCGCGCGTTCGGCGACCGCATCCCGGACGGCGTCTTCTCGCCCGCCGAGCTGCAGGGCT
TCCTGCTCAAGCGCAAGAAGGGCCCGTGCCGGGCGGCTGACGAGGTGAGCGCTTGGGCTGAGGCGCTGCTGCGGC
AGAAGGAGGCCAACTCCAAGGCCGTGACGGTGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail