Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9461
Gene name
LocationContig_690:623..4467
Strand-
Gene length (bp)3844
Transcript length (bp)3435
Coding sequence length (bp)3435
Protein length (aa) 1145

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15411 PH_10 Pleckstrin homology domain 9.9E-29 418 532
PF00092 VWA von Willebrand factor type A domain 6.2E-15 608 773
PF13768 VWA_3 von Willebrand factor type A domain 1.2E-09 608 761

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9461
MFSRARRSQRQRINDAGPPPPNEPRSQNLHLPSRLTDLSLIINAQPASRSRPQPDEPVYQLKGNNPFPAEPHGEF
AYRRDSLVDSASSLLGAAPRRVGGIDNNVMASTAERSRLRRERTFVGSECAVCEEPLEHTLQGERILQFSCSHVS
HEACFYEFIRELEAQYCPTCDAPLHLDTSRGGNVIDINKITNMMRSAGSDARSTNTPTPTWDNQTVRPPSLDSSQ
RNHHAQPPSSNGRESAARGSYRDSRDAPLSDRYGSSRHARSDSEVTGVTSSGGYPETAQSGPPWRHDYDVQAMET
TPGSPRAISRNPVPPPTVTVRSEFPTINRCRQQQTLTCLVTIEVPGNKWRPDPEDIGVQALPPPPVSARIDEVAA
RSVLTSGSGGPRFFPYESAEVLEEMTETLRNRVDNWHGLDFGKFGQLRLYGTLRVGKDKVSWQELECYLFAEMLI
CVKEKKLPSQAAPQWDGSGPPRRPTRCTLKGSILIKKHLNEVVETGTIDENVLTLSLSVGELPQFHLRFENRNQL
KLWNQALLDLNAIEDFPVRSPDFDRGDMSETDDEIDWHRSRPQRVSSTASSWGPRSVTTAPTEYTNFAARSPYAN
GCIHVPIDVVVVVPISSSMQGVKINLVRDALKFMVSNLGERDRMGLVTFGSGGGGVPIVGMTTKAWPGWSNILSS
IKPVGQKSHRADVVEGANVAMDLLMQRKHNNPIATIMLISDASTADADSVDFVVSRAEAAKITIHSFGLGMTHKP
DTMIELSTRTKASYTYVKDWMMLRECLAGCLGGMQTLSHQNVKLKLKLPEGSPAKFHKISGALQITKRATGRDAE
ASLGDLRFGDKRDILVQLVIMPDSSSQEQLPQDPWDNIVSGLEALGGSMDNDGERAVSVEEVPLIQADLSWGDIL
RDGTVTHMPRPSLLAITMLPTSSGSKKSWQNTPPIPPHPSIVQRRMELLTSDMLTRALTLVSRGQHDRAHTLLNE
TRSILKGLGKGGLPPVPQSASKSAPSTPHPVSDASPNSNGTPDRKRSPSPPTSAASSGGNGFASAQLGRSRSNDG
FGLGTGIDPSTVAALDTELESSLEWINHPAVFGRDSRKAVLQAIGVISSQRAFTFRTPIESLWGGRVSGIKRLAD
KSREWREEGGGEGGIMEEA*
Coding >Hirsu2|9461
ATGTTTAGCCGGGCTCGACGAAGCCAGCGGCAGCGGATCAACGACGCCGGCCCCCCTCCTCCCAACGAGCCAAGG
AGCCAAAATCTACATCTGCCGTCGCGCTTGACGGACCTGAGCCTAATCATCAACGCCCAGCCTGCCTCGCGATCC
AGGCCCCAACCCGATGAGCCCGTCTACCAGCTGAAGGGCAATAATCCCTTTCCTGCCGAGCCTCACGGCGAATTC
GCCTACCGGCGCGACTCGCTTGTAGACTCGGCCTCGTCGCTCCTCGGCGCCGCTCCCCGGAGGGTCGGCGGCATC
GACAACAACGTCATGGCCAGCACCGCCGAGCGAAGCCGCCTGCGCCGCGAGAGGACCTTCGTCGGCAGCGAATGC
GCCGTCTGCGAGGAGCCCCTCGAGCACACGTTGCAGGGCGAGCGCATCCTCCAGTTCTCTTGCTCCCACGTCTCC
CACGAGGCCTGCTTTTACGAGTTCATCCGCGAGCTCGAGGCGCAATACTGCCCGACATGTGACGCGCCCTTGCAT
CTCGACACCAGCCGCGGCGGCAATGTCATCGACATCAACAAGATCACAAACATGATGCGCTCTGCCGGCAGCGAC
GCGCGCTCCACCAACACGCCCACGCCAACCTGGGATAACCAGACCGTGAGGCCGCCCAGCCTCGACAGCTCGCAG
CGGAACCACCACGCCCAGCCGCCCAGCAGCAACGGCAGGGAGAGCGCCGCCCGGGGGAGCTACCGCGACAGCCGC
GACGCCCCCCTCTCCGACCGCTACGGCTCCTCGAGGCATGCGCGCAGCGACAGCGAGGTCACCGGCGTCACCTCG
TCGGGTGGCTATCCCGAGACGGCCCAGAGCGGCCCGCCCTGGCGCCACGACTACGACGTGCAGGCCATGGAGACG
ACGCCCGGCAGCCCGCGTGCCATCTCGCGCAACCCCGTGCCCCCCCCGACCGTCACGGTGCGATCCGAATTCCCG
ACCATCAACCGCTGTCGCCAGCAGCAAACCCTCACCTGCCTCGTCACCATCGAGGTCCCGGGCAACAAGTGGAGG
CCCGACCCCGAGGACATCGGTGTCCAGGCGTTGCCGCCCCCGCCCGTCAGCGCCCGCATTGACGAGGTCGCTGCG
CGCTCAGTCCTCACCTCCGGCTCCGGCGGACCCCGCTTCTTCCCCTACGAGTCAGCCGAGGTGCTGGAGGAGATG
ACGGAGACGCTGCGCAATCGCGTCGACAACTGGCATGGCCTGGACTTTGGCAAGTTCGGACAGTTGCGCCTCTAC
GGCACCCTCCGCGTCGGCAAGGACAAGGTCTCTTGGCAGGAGCTCGAGTGTTATCTCTTCGCCGAGATGCTCATC
TGCGTCAAGGAGAAGAAGCTGCCGTCCCAGGCCGCGCCCCAATGGGACGGCAGCGGCCCGCCCAGACGCCCGACT
CGCTGCACCCTCAAGGGCTCCATCCTCATCAAGAAGCACCTGAACGAGGTGGTCGAGACCGGCACTATTGACGAG
AACGTCCTAACTCTGAGCCTCTCCGTCGGCGAGCTGCCCCAGTTCCACCTGAGGTTCGAGAACCGCAACCAGCTC
AAGCTGTGGAACCAGGCCCTCCTCGACCTCAACGCCATCGAAGACTTCCCCGTCCGCAGCCCGGACTTCGACCGC
GGCGACATGTCCGAGACGGACGACGAGATCGACTGGCACCGCTCGCGGCCCCAGCGCGTCTCCTCGACGGCCTCG
TCCTGGGGGCCGCGCTCCGTGACCACGGCGCCGACCGAGTACACCAACTTCGCCGCCAGGAGCCCCTATGCCAAC
GGCTGCATCCACGTGCCCATCGACGTCGTCGTTGTCGTCCCCATATCCTCCTCCATGCAGGGTGTCAAGATCAAC
CTGGTGCGCGACGCGCTCAAGTTCATGGTCAGCAACCTGGGCGAGAGGGACCGCATGGGCCTCGTCACCTTCGGC
TCCGGCGGCGGCGGCGTGCCCATCGTCGGCATGACGACCAAGGCCTGGCCCGGCTGGTCCAACATCCTGTCCTCG
ATTAAGCCCGTCGGCCAGAAGAGCCACCGCGCGGACGTGGTGGAGGGGGCCAACGTCGCCATGGACCTGCTCATG
CAGCGCAAGCACAACAACCCCATCGCCACCATCATGCTCATCAGCGACGCCTCCACAGCCGACGCCGACTCTGTC
GACTTCGTCGTCTCCCGCGCCGAGGCGGCCAAGATCACCATCCACTCCTTTGGCCTCGGCATGACGCACAAGCCC
GACACCATGATCGAGCTGTCGACGAGGACCAAAGCCTCGTACACGTACGTCAAGGACTGGATGATGCTCCGAGAG
TGTCTTGCCGGCTGCCTCGGCGGGATGCAGACGTTATCCCACCAGAACGTCAAACTCAAGCTCAAGCTCCCCGAG
GGCTCGCCCGCAAAGTTCCACAAGATCAGCGGCGCGCTGCAGATCACGAAGCGCGCCACGGGCCGCGACGCCGAG
GCAAGCCTGGGCGACCTGCGCTTCGGCGACAAGCGAGACATACTCGTCCAGCTCGTCATCATGCCCGACAGCTCG
TCGCAGGAGCAGCTGCCGCAGGACCCCTGGGACAACATCGTCTCGGGGCTGGAGGCGCTCGGCGGCTCCATGGAC
AATGACGGCGAGAGGGCCGTGTCCGTCGAGGAGGTTCCGCTCATCCAGGCCGACCTCAGCTGGGGCGACATCCTG
CGCGACGGCACCGTCACACACATGCCGCGGCCGTCCCTCCTGGCCATCACGATGCTGCCGACCAGCTCCGGGTCC
AAGAAGTCGTGGCAGAACACGCCGCCCATCCCGCCCCACCCCAGCATCGTGCAGCGGCGCATGGAGCTGCTGACG
TCGGACATGCTCACCCGCGCCCTGACGCTCGTCAGCCGCGGCCAGCACGACCGGGCGCACACCCTGCTCAACGAG
ACGAGGTCCATCCTCAAGGGCCTCGGCAAGGGCGGCCTGCCCCCGGTTCCGCAGTCGGCCAGCAAGTCGGCGCCC
TCGACGCCGCACCCGGTCAGCGACGCGTCGCCCAACTCCAACGGGACCCCCGACCGGAAGCGCAGCCCGTCGCCG
CCCACGTCGGCCGCCTCGTCCGGCGGCAATGGCTTCGCCTCGGCCCAGCTCGGCCGCAGCCGGTCCAACGACGGC
TTCGGCCTCGGCACCGGCATCGACCCCAGCACCGTCGCCGCCCTCGACACGGAGCTGGAGAGCAGCCTAGAGTGG
ATCAACCACCCGGCCGTCTTCGGCCGCGACAGCCGCAAGGCCGTGCTGCAGGCCATCGGCGTCATCAGCTCGCAG
CGCGCCTTCACCTTCCGCACGCCCATCGAGAGCCTGTGGGGCGGCCGCGTCAGCGGCATCAAGCGCCTGGCCGAC
AAGAGTCGCGAGTGGCGCGAGGAGGGCGGCGGCGAGGGCGGCATCATGGAGGAGGCCTAA
Transcript >Hirsu2|9461
ATGTTTAGCCGGGCTCGACGAAGCCAGCGGCAGCGGATCAACGACGCCGGCCCCCCTCCTCCCAACGAGCCAAGG
AGCCAAAATCTACATCTGCCGTCGCGCTTGACGGACCTGAGCCTAATCATCAACGCCCAGCCTGCCTCGCGATCC
AGGCCCCAACCCGATGAGCCCGTCTACCAGCTGAAGGGCAATAATCCCTTTCCTGCCGAGCCTCACGGCGAATTC
GCCTACCGGCGCGACTCGCTTGTAGACTCGGCCTCGTCGCTCCTCGGCGCCGCTCCCCGGAGGGTCGGCGGCATC
GACAACAACGTCATGGCCAGCACCGCCGAGCGAAGCCGCCTGCGCCGCGAGAGGACCTTCGTCGGCAGCGAATGC
GCCGTCTGCGAGGAGCCCCTCGAGCACACGTTGCAGGGCGAGCGCATCCTCCAGTTCTCTTGCTCCCACGTCTCC
CACGAGGCCTGCTTTTACGAGTTCATCCGCGAGCTCGAGGCGCAATACTGCCCGACATGTGACGCGCCCTTGCAT
CTCGACACCAGCCGCGGCGGCAATGTCATCGACATCAACAAGATCACAAACATGATGCGCTCTGCCGGCAGCGAC
GCGCGCTCCACCAACACGCCCACGCCAACCTGGGATAACCAGACCGTGAGGCCGCCCAGCCTCGACAGCTCGCAG
CGGAACCACCACGCCCAGCCGCCCAGCAGCAACGGCAGGGAGAGCGCCGCCCGGGGGAGCTACCGCGACAGCCGC
GACGCCCCCCTCTCCGACCGCTACGGCTCCTCGAGGCATGCGCGCAGCGACAGCGAGGTCACCGGCGTCACCTCG
TCGGGTGGCTATCCCGAGACGGCCCAGAGCGGCCCGCCCTGGCGCCACGACTACGACGTGCAGGCCATGGAGACG
ACGCCCGGCAGCCCGCGTGCCATCTCGCGCAACCCCGTGCCCCCCCCGACCGTCACGGTGCGATCCGAATTCCCG
ACCATCAACCGCTGTCGCCAGCAGCAAACCCTCACCTGCCTCGTCACCATCGAGGTCCCGGGCAACAAGTGGAGG
CCCGACCCCGAGGACATCGGTGTCCAGGCGTTGCCGCCCCCGCCCGTCAGCGCCCGCATTGACGAGGTCGCTGCG
CGCTCAGTCCTCACCTCCGGCTCCGGCGGACCCCGCTTCTTCCCCTACGAGTCAGCCGAGGTGCTGGAGGAGATG
ACGGAGACGCTGCGCAATCGCGTCGACAACTGGCATGGCCTGGACTTTGGCAAGTTCGGACAGTTGCGCCTCTAC
GGCACCCTCCGCGTCGGCAAGGACAAGGTCTCTTGGCAGGAGCTCGAGTGTTATCTCTTCGCCGAGATGCTCATC
TGCGTCAAGGAGAAGAAGCTGCCGTCCCAGGCCGCGCCCCAATGGGACGGCAGCGGCCCGCCCAGACGCCCGACT
CGCTGCACCCTCAAGGGCTCCATCCTCATCAAGAAGCACCTGAACGAGGTGGTCGAGACCGGCACTATTGACGAG
AACGTCCTAACTCTGAGCCTCTCCGTCGGCGAGCTGCCCCAGTTCCACCTGAGGTTCGAGAACCGCAACCAGCTC
AAGCTGTGGAACCAGGCCCTCCTCGACCTCAACGCCATCGAAGACTTCCCCGTCCGCAGCCCGGACTTCGACCGC
GGCGACATGTCCGAGACGGACGACGAGATCGACTGGCACCGCTCGCGGCCCCAGCGCGTCTCCTCGACGGCCTCG
TCCTGGGGGCCGCGCTCCGTGACCACGGCGCCGACCGAGTACACCAACTTCGCCGCCAGGAGCCCCTATGCCAAC
GGCTGCATCCACGTGCCCATCGACGTCGTCGTTGTCGTCCCCATATCCTCCTCCATGCAGGGTGTCAAGATCAAC
CTGGTGCGCGACGCGCTCAAGTTCATGGTCAGCAACCTGGGCGAGAGGGACCGCATGGGCCTCGTCACCTTCGGC
TCCGGCGGCGGCGGCGTGCCCATCGTCGGCATGACGACCAAGGCCTGGCCCGGCTGGTCCAACATCCTGTCCTCG
ATTAAGCCCGTCGGCCAGAAGAGCCACCGCGCGGACGTGGTGGAGGGGGCCAACGTCGCCATGGACCTGCTCATG
CAGCGCAAGCACAACAACCCCATCGCCACCATCATGCTCATCAGCGACGCCTCCACAGCCGACGCCGACTCTGTC
GACTTCGTCGTCTCCCGCGCCGAGGCGGCCAAGATCACCATCCACTCCTTTGGCCTCGGCATGACGCACAAGCCC
GACACCATGATCGAGCTGTCGACGAGGACCAAAGCCTCGTACACGTACGTCAAGGACTGGATGATGCTCCGAGAG
TGTCTTGCCGGCTGCCTCGGCGGGATGCAGACGTTATCCCACCAGAACGTCAAACTCAAGCTCAAGCTCCCCGAG
GGCTCGCCCGCAAAGTTCCACAAGATCAGCGGCGCGCTGCAGATCACGAAGCGCGCCACGGGCCGCGACGCCGAG
GCAAGCCTGGGCGACCTGCGCTTCGGCGACAAGCGAGACATACTCGTCCAGCTCGTCATCATGCCCGACAGCTCG
TCGCAGGAGCAGCTGCCGCAGGACCCCTGGGACAACATCGTCTCGGGGCTGGAGGCGCTCGGCGGCTCCATGGAC
AATGACGGCGAGAGGGCCGTGTCCGTCGAGGAGGTTCCGCTCATCCAGGCCGACCTCAGCTGGGGCGACATCCTG
CGCGACGGCACCGTCACACACATGCCGCGGCCGTCCCTCCTGGCCATCACGATGCTGCCGACCAGCTCCGGGTCC
AAGAAGTCGTGGCAGAACACGCCGCCCATCCCGCCCCACCCCAGCATCGTGCAGCGGCGCATGGAGCTGCTGACG
TCGGACATGCTCACCCGCGCCCTGACGCTCGTCAGCCGCGGCCAGCACGACCGGGCGCACACCCTGCTCAACGAG
ACGAGGTCCATCCTCAAGGGCCTCGGCAAGGGCGGCCTGCCCCCGGTTCCGCAGTCGGCCAGCAAGTCGGCGCCC
TCGACGCCGCACCCGGTCAGCGACGCGTCGCCCAACTCCAACGGGACCCCCGACCGGAAGCGCAGCCCGTCGCCG
CCCACGTCGGCCGCCTCGTCCGGCGGCAATGGCTTCGCCTCGGCCCAGCTCGGCCGCAGCCGGTCCAACGACGGC
TTCGGCCTCGGCACCGGCATCGACCCCAGCACCGTCGCCGCCCTCGACACGGAGCTGGAGAGCAGCCTAGAGTGG
ATCAACCACCCGGCCGTCTTCGGCCGCGACAGCCGCAAGGCCGTGCTGCAGGCCATCGGCGTCATCAGCTCGCAG
CGCGCCTTCACCTTCCGCACGCCCATCGAGAGCCTGTGGGGCGGCCGCGTCAGCGGCATCAAGCGCCTGGCCGAC
AAGAGTCGCGAGTGGCGCGAGGAGGGCGGCGGCGAGGGCGGCATCATGGAGGAGGCCTAA
Gene >Hirsu2|9461
ATGTTTAGCCGGGCTCGACGAAGCCAGCGGCAGCGGATCAACGACGCCGGCCCCCCTCCTCCCAACGAGCCAAGG
AGCCAAAATCTACATCTGCCGTCGCGCTTGACGGACCTGAGCCTAATCATCAACGCCCAGCCTGCCTCGCGATCC
AGGCCCCAACCCGATGAGCCCGTCTACCAGCTGAAGGGTAGGCCTCCGACCACCTCCTCTCCCTCGCTCCCCGCT
TCTGCCAAACACATACTCCCTGTGCTTCTGCTCTTGGCCTAGGCCTCATCCTGGATATCCCTTCCCTTTGCTTTC
CTGCTCCAAATTTTTTTTTCCTTTGTACCCTTTCTTCCTCTCTACCTTTCCTCCCCAGTCTTCCCTTCTTCTCCA
GTCTTCCTCTCCTCCAGTCTTTCTGCCTGCCCTCTTCCGTCCCAGAGAGGGTCCGGCCCTGCTGGCCTTCTCGCT
CGACTGACGCCGCCCAGGCAATAATCCCTTTCCTGCCGAGCCTCACGGCGAATTCGCCTACCGGCGCGACTCGCT
TGTAGACTCGGCCTCGTCGCTCCTCGGCGCCGCTCCCCGGAGGGTCGGCGGCATCGACAACAACGTCATGGCCAG
CACCGCCGAGCGAAGCCGCCTGCGCCGCGAGAGGACCTTCGTCGGCAGCGAATGCGCCGTCTGCGAGGAGCCCCT
CGAGCACACGTTGCAGGGCGAGCGCATCCTCCAGTTCTCTTGCTCCCACGTCTCCCACGAGGCCTGCTTTTACGA
GTTCATCCGCGAGCTCGAGGCGCAATACTGCCCGACATGTGACGCGCCCTTGCATCTCGACACCAGCCGCGGCGG
CAATGTCATCGACATCAGTTCGTTTCCCCCGCCGCCGCTCCGACGGACCCCCCTCCCCGAGCCAGGTCCGTTGAC
GCCAGATCCAGACAAGATCACAAACATGATGCGCTCTGCCGGCAGCGACGCGCGCTCCACCAACACGCCCACGCC
AACCTGGGATAACCAGACCGTGAGGCCGCCCAGCCTCGACAGCTCGCAGCGGAACCACCACGCCCAGCCGCCCAG
CAGCAACGGCAGGGAGAGCGCCGCCCGGGGGAGCTACCGCGACAGCCGCGACGCCCCCCTCTCCGACCGCTACGG
CTCCTCGAGGCATGCGCGCAGCGACAGCGAGGTCACCGGCGTCACCTCGTCGGGTGGCTATCCCGAGACGGCCCA
GAGCGGCCCGCCCTGGCGCCACGACTACGACGTGCAGGCCATGGAGACGACGCCCGGCAGCCCGCGTGCCATCTC
GCGCAACCCCGTGCCCCCCCCGACCGTCACGGTGCGATCCGAATTCCCGACCATCAACCGCTGTCGCCAGCAGCA
AACCCTCACCTGCCTCGTCACCATCGAGGTCCCGGGCAACAAGTGGAGGCCCGACCCCGAGGACATCGGTGTCCA
GGCGTTGCCGCCCCCGCCCGTCAGCGCCCGCATTGACGAGGTCGCTGCGCGCTCAGTCCTCACCTCCGGCTCCGG
CGGACCCCGCTTCTTCCCCTACGAGTCAGCCGAGGTGCTGGAGGAGATGACGGAGACGCTGCGCAATCGCGTCGA
CAACTGGCATGGCCTGGACTTTGGCAAGTGAGTCTGCCCCTCTACCGCCGCTGCGCGCCGCCGCAGACGACTGAC
AGTCTGCGCCAGGTTCGGACAGTTGCGCCTCTACGGCACCCTCCGCGTCGGCAAGGACAAGGTCTCTTGGCAGGA
GCTCGAGTGTTATCTCTTCGCCGAGATGCTCATCTGCGTCAAGGAGAAGAAGCTGCCGTCCCAGGCCGCGCCCCA
ATGGGACGGCAGCGGCCCGCCCAGACGCCCGACTCGCTGCACCCTCAAGGGCTCCATCCTCATCAAGAAGCACCT
GAACGAGGTGGTCGAGACCGGCACTATTGACGAGAACGTCCTAACTCTGAGCCTCTCCGTCGGCGAGCTGCCCCA
GTTCCACCTGAGGTTCGAGAACCGCAACCAGCTCAAGCTGTGGAACCAGGCCCTCCTCGACCTCAACGCCATCGA
AGACTTCCCCGTCCGCAGCCCGGACTTCGACCGCGGCGACATGTCCGAGACGGACGACGAGATCGACTGGCACCG
CTCGCGGCCCCAGCGCGTCTCCTCGACGGCCTCGTCCTGGGGGCCGCGCTCCGTGACCACGGCGCCGACCGAGTA
CACCAACTTCGCCGCCAGGAGCCCCTATGCCAACGGCTGCATCCACGTGCCCATCGACGTCGTCGTTGTCGTCCC
CATATCCTCCTCCATGCAGGGTGTCAAGATCAACCTGGTGCGCGACGCGCTCAAGTTCATGGTCAGCAACCTGGG
CGAGAGGGACCGCATGGGCCTCGTCACCTTCGGCTCCGGCGGCGGCGGCGTGCCCATCGTCGGCATGACGACCAA
GGCCTGGCCCGGCTGGTCCAACATCCTGTCCTCGATTAAGCCCGTCGGCCAGAAGAGCCACCGCGCGGACGTGGT
GGAGGGGGCCAACGTCGCCATGGACCTGCTCATGCAGCGCAAGCACAACAACCCCATCGCCACCATCATGCTCAT
CAGCGACGCCTCCACAGCCGACGCCGACTCTGTCGACTTCGTCGTCTCCCGCGCCGAGGCGGCCAAGATCACCAT
CCACTCCTTTGGCCTCGGCATGACGCACAAGCCCGACACCATGATCGAGCTGTCGACGAGGACCAAAGCCTCGTA
CACGTACGTCAAGGACTGGATGATGCTCCGAGAGTGTCTTGCCGGCTGCCTCGGCGGGATGCAGACGTTATCCCA
CCAGAACGTCAAACTCAAGCTCAAGCTCCCCGAGGGCTCGCCCGCAAAGTTCCACAAGATCAGCGGCGCGCTGCA
GATCACGAAGCGCGCCACGGGCCGCGACGCCGAGGCAAGCCTGGGCGACCTGCGCTTCGGCGACAAGCGAGACAT
ACTCGTCCAGCTCGTCATCATGCCCGACAGCTCGTCGCAGGAGCAGCTGCCGCAGGACCCCTGGGACAACATCGT
CTCGGGGCTGGAGGCGCTCGGCGGCTCCATGGACAATGACGGCGAGAGGGCCGTGTCCGTCGAGGAGGTTCCGCT
CATCCAGGCCGACCTCAGCTGGGGCGACATCCTGCGCGACGGCACCGTCACACACATGCCGCGGCCGTCCCTCCT
GGCCATCACGATGCTGCCGACCAGCTCCGGGTCCAAGAAGTCGTGGCAGAACACGCCGCCCATCCCGCCCCACCC
CAGCATCGTGCAGCGGCGCATGGAGCTGCTGACGTCGGACATGCTCACCCGCGCCCTGACGCTCGTCAGCCGCGG
CCAGCACGACCGGGCGCACACCCTGCTCAACGAGACGAGGTCCATCCTCAAGGGCCTCGGCAAGGGCGGCCTGCC
CCCGGTTCCGCAGTCGGCCAGCAAGTCGGCGCCCTCGACGCCGCACCCGGTCAGCGACGCGTCGCCCAACTCCAA
CGGGACCCCCGACCGGAAGCGCAGCCCGTCGCCGCCCACGTCGGCCGCCTCGTCCGGCGGCAATGGCTTCGCCTC
GGCCCAGCTCGGCCGCAGCCGGTCCAACGACGGCTTCGGCCTCGGCACCGGCATCGACCCCAGCACCGTCGCCGC
CCTCGACACGGAGCTGGAGAGCAGCCTAGAGTGGATCAACCACCCGGCCGTCTTCGGCCGCGACAGCCGCAAGGC
CGTGCTGCAGGCCATCGGCGTCATCAGCTCGCAGCGCGCCTTCACCTTCCGCACGCCCATCGAGAGCCTGTGGGG
CGGCCGCGTCAGCGGCATCAAGCGCCTGGCCGACAAGAGTCGCGAGTGGCGCGAGGAGGGCGGCGGCGAGGGCGG
CATCATGGAGGAGGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail