Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9455
Gene name
LocationContig_69:22154..24053
Strand+
Gene length (bp)1899
Transcript length (bp)1899
Coding sequence length (bp)1899
Protein length (aa) 633

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12770 CHAT CHAT domain 8.9E-39 342 631

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.8092 0.7435 0.032 0.0468 0.2408 0.0167 0.0397 0.0539 0.1712 0.0011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup531
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4184
Ophiocordyceps camponoti-rufipedis Ophun1|5383
Ophiocordyceps kimflemingae Ophio5|7314
Ophiocordyceps subramaniannii Hirsu2|3302
Ophiocordyceps subramaniannii Hirsu2|61
Ophiocordyceps subramaniannii Hirsu2|9455 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9455
MSDLEEAIAVARQVIKLTDNHPVRPACLNNLGNKLERRYQRTGEVDALEQAILVARHAVSLTAEDHPDRAAWLTN
CGVKLEMRHELTGEPADVQEATACHLGAWNCRAAIPLHRVKAAAPCIKLLATQGKFEAAADLGKEVVDLLPTVNT
RLLGRGDQQFVMSTFAGVATDLCALLLKTNRPIEALQYLEKGRAAIIGRLIDKRSDASELARCNPDMASRYKSLL
DEVNKPLEGLEQGPNRRREAAAALDACIREIRSLAGHERFLLGLTTAEMQECASGGSIVVVNITYIRSDAIIVSP
GGIKALKLAALSASDTSVWLNQDWSGRRSERREKNMLYSRHLAWLWDVCVAQIVQEVRAAHDLLEGCLPRVWWIG
TGLASSLPFHAAGTHTVGSAENAYSKVVSSYTPSIKALAYSQSRVRRDRGTRQSLLIASMPTTPGLRKLPGVIEE
TGRVSQVADGHGLAIELLENPSVESVVEGLQRCSIAHFACHGSTDHRDPSNSGLVFQKSAAEHDRLSVYRISDLS
QEQARLAYLSACSTAENKAARLTDEVIHIVSGLQVAGFPHAVGCLWPSVDRVCVEVARRFYSSFLGREGLGWRDG
AVARSLREAVVAVRSDDYDMPLNWAQFVHYGA*
Coding >Hirsu2|9455
ATGTCGGACCTCGAGGAGGCAATCGCGGTGGCAAGGCAGGTCATCAAACTGACGGACAACCACCCGGTGCGTCCC
GCGTGTCTTAATAATCTCGGAAACAAGCTCGAGAGGCGTTACCAGCGTACGGGCGAAGTCGACGCCCTTGAGCAA
GCCATCTTGGTGGCAAGGCATGCCGTGAGCCTGACAGCCGAGGACCATCCCGACCGTGCGGCCTGGTTGACCAAC
TGCGGAGTGAAGCTGGAGATGCGGCACGAACTCACAGGAGAGCCAGCTGATGTCCAAGAGGCCACCGCATGTCAC
CTCGGCGCCTGGAACTGCCGAGCAGCAATCCCCCTGCATCGGGTGAAAGCCGCGGCGCCATGCATCAAGCTGCTG
GCCACACAGGGCAAGTTCGAAGCCGCCGCGGACCTCGGAAAAGAAGTCGTCGACCTGCTGCCGACGGTGAATACT
AGGCTTCTCGGCCGGGGCGACCAGCAGTTCGTCATGTCTACCTTTGCCGGGGTCGCCACCGACCTCTGCGCCTTG
CTGCTGAAAACGAACCGGCCAATAGAGGCTCTGCAGTATCTCGAAAAGGGCCGCGCGGCCATCATTGGGCGGCTC
ATCGACAAGCGCAGTGATGCGTCTGAGCTGGCGCGATGCAACCCGGACATGGCCAGTCGGTACAAGAGCCTGCTG
GACGAGGTCAACAAGCCCCTGGAGGGCCTCGAGCAGGGTCCGAACCGAAGACGCGAGGCGGCGGCGGCGCTGGAC
GCGTGCATACGAGAGATTAGGTCTCTCGCCGGCCACGAACGCTTTCTCCTGGGCTTGACGACTGCCGAAATGCAA
GAGTGCGCCTCGGGAGGCAGCATAGTTGTCGTGAACATTACCTACATTCGGAGCGATGCCATTATTGTCTCCCCG
GGGGGCATCAAGGCTTTGAAGCTTGCTGCCTTGTCGGCCTCCGATACGAGTGTCTGGCTGAACCAAGACTGGAGC
GGGCGTAGGTCGGAGCGCAGAGAGAAGAACATGCTCTATTCTCGCCATCTTGCCTGGCTGTGGGACGTCTGTGTC
GCACAGATCGTGCAAGAGGTTCGTGCCGCCCACGATCTGTTGGAGGGTTGTCTCCCGAGAGTGTGGTGGATCGGA
ACGGGCCTTGCATCCTCTCTGCCATTCCACGCCGCCGGCACTCACACCGTCGGCTCGGCGGAGAACGCTTATAGC
AAGGTCGTGTCGTCGTACACACCCTCCATCAAAGCGCTCGCATACTCTCAGAGTCGAGTGAGACGCGATCGAGGG
ACGCGGCAATCACTACTCATAGCAAGCATGCCGACGACGCCGGGCCTGCGCAAGCTTCCAGGCGTCATCGAAGAG
ACGGGGCGAGTATCGCAAGTCGCAGACGGCCACGGCCTCGCCATCGAGCTGCTCGAGAATCCCTCGGTGGAGAGC
GTCGTCGAGGGCCTACAGCGCTGCTCCATCGCGCACTTCGCCTGCCACGGGTCGACGGACCACCGGGATCCGTCC
AACAGCGGGCTGGTGTTCCAGAAGAGCGCGGCGGAACACGACAGACTCAGCGTTTACCGTATCTCAGACCTCAGC
CAGGAGCAGGCGCGGCTGGCATACCTATCGGCATGCTCGACGGCGGAGAACAAGGCGGCGCGGCTGACGGACGAG
GTGATTCACATTGTCAGCGGGTTGCAGGTGGCGGGCTTTCCCCATGCCGTCGGCTGCCTGTGGCCGTCGGTCGAC
CGAGTTTGCGTCGAGGTGGCCAGACGCTTCTACTCGTCCTTCCTCGGGAGGGAGGGACTCGGATGGCGCGATGGA
GCCGTGGCACGGTCGCTGAGAGAGGCCGTCGTGGCTGTCAGAAGCGACGACTATGACATGCCCCTGAACTGGGCG
CAGTTTGTTCACTACGGGGCATGA
Transcript >Hirsu2|9455
ATGTCGGACCTCGAGGAGGCAATCGCGGTGGCAAGGCAGGTCATCAAACTGACGGACAACCACCCGGTGCGTCCC
GCGTGTCTTAATAATCTCGGAAACAAGCTCGAGAGGCGTTACCAGCGTACGGGCGAAGTCGACGCCCTTGAGCAA
GCCATCTTGGTGGCAAGGCATGCCGTGAGCCTGACAGCCGAGGACCATCCCGACCGTGCGGCCTGGTTGACCAAC
TGCGGAGTGAAGCTGGAGATGCGGCACGAACTCACAGGAGAGCCAGCTGATGTCCAAGAGGCCACCGCATGTCAC
CTCGGCGCCTGGAACTGCCGAGCAGCAATCCCCCTGCATCGGGTGAAAGCCGCGGCGCCATGCATCAAGCTGCTG
GCCACACAGGGCAAGTTCGAAGCCGCCGCGGACCTCGGAAAAGAAGTCGTCGACCTGCTGCCGACGGTGAATACT
AGGCTTCTCGGCCGGGGCGACCAGCAGTTCGTCATGTCTACCTTTGCCGGGGTCGCCACCGACCTCTGCGCCTTG
CTGCTGAAAACGAACCGGCCAATAGAGGCTCTGCAGTATCTCGAAAAGGGCCGCGCGGCCATCATTGGGCGGCTC
ATCGACAAGCGCAGTGATGCGTCTGAGCTGGCGCGATGCAACCCGGACATGGCCAGTCGGTACAAGAGCCTGCTG
GACGAGGTCAACAAGCCCCTGGAGGGCCTCGAGCAGGGTCCGAACCGAAGACGCGAGGCGGCGGCGGCGCTGGAC
GCGTGCATACGAGAGATTAGGTCTCTCGCCGGCCACGAACGCTTTCTCCTGGGCTTGACGACTGCCGAAATGCAA
GAGTGCGCCTCGGGAGGCAGCATAGTTGTCGTGAACATTACCTACATTCGGAGCGATGCCATTATTGTCTCCCCG
GGGGGCATCAAGGCTTTGAAGCTTGCTGCCTTGTCGGCCTCCGATACGAGTGTCTGGCTGAACCAAGACTGGAGC
GGGCGTAGGTCGGAGCGCAGAGAGAAGAACATGCTCTATTCTCGCCATCTTGCCTGGCTGTGGGACGTCTGTGTC
GCACAGATCGTGCAAGAGGTTCGTGCCGCCCACGATCTGTTGGAGGGTTGTCTCCCGAGAGTGTGGTGGATCGGA
ACGGGCCTTGCATCCTCTCTGCCATTCCACGCCGCCGGCACTCACACCGTCGGCTCGGCGGAGAACGCTTATAGC
AAGGTCGTGTCGTCGTACACACCCTCCATCAAAGCGCTCGCATACTCTCAGAGTCGAGTGAGACGCGATCGAGGG
ACGCGGCAATCACTACTCATAGCAAGCATGCCGACGACGCCGGGCCTGCGCAAGCTTCCAGGCGTCATCGAAGAG
ACGGGGCGAGTATCGCAAGTCGCAGACGGCCACGGCCTCGCCATCGAGCTGCTCGAGAATCCCTCGGTGGAGAGC
GTCGTCGAGGGCCTACAGCGCTGCTCCATCGCGCACTTCGCCTGCCACGGGTCGACGGACCACCGGGATCCGTCC
AACAGCGGGCTGGTGTTCCAGAAGAGCGCGGCGGAACACGACAGACTCAGCGTTTACCGTATCTCAGACCTCAGC
CAGGAGCAGGCGCGGCTGGCATACCTATCGGCATGCTCGACGGCGGAGAACAAGGCGGCGCGGCTGACGGACGAG
GTGATTCACATTGTCAGCGGGTTGCAGGTGGCGGGCTTTCCCCATGCCGTCGGCTGCCTGTGGCCGTCGGTCGAC
CGAGTTTGCGTCGAGGTGGCCAGACGCTTCTACTCGTCCTTCCTCGGGAGGGAGGGACTCGGATGGCGCGATGGA
GCCGTGGCACGGTCGCTGAGAGAGGCCGTCGTGGCTGTCAGAAGCGACGACTATGACATGCCCCTGAACTGGGCG
CAGTTTGTTCACTACGGGGCATGA
Gene >Hirsu2|9455
ATGTCGGACCTCGAGGAGGCAATCGCGGTGGCAAGGCAGGTCATCAAACTGACGGACAACCACCCGGTGCGTCCC
GCGTGTCTTAATAATCTCGGAAACAAGCTCGAGAGGCGTTACCAGCGTACGGGCGAAGTCGACGCCCTTGAGCAA
GCCATCTTGGTGGCAAGGCATGCCGTGAGCCTGACAGCCGAGGACCATCCCGACCGTGCGGCCTGGTTGACCAAC
TGCGGAGTGAAGCTGGAGATGCGGCACGAACTCACAGGAGAGCCAGCTGATGTCCAAGAGGCCACCGCATGTCAC
CTCGGCGCCTGGAACTGCCGAGCAGCAATCCCCCTGCATCGGGTGAAAGCCGCGGCGCCATGCATCAAGCTGCTG
GCCACACAGGGCAAGTTCGAAGCCGCCGCGGACCTCGGAAAAGAAGTCGTCGACCTGCTGCCGACGGTGAATACT
AGGCTTCTCGGCCGGGGCGACCAGCAGTTCGTCATGTCTACCTTTGCCGGGGTCGCCACCGACCTCTGCGCCTTG
CTGCTGAAAACGAACCGGCCAATAGAGGCTCTGCAGTATCTCGAAAAGGGCCGCGCGGCCATCATTGGGCGGCTC
ATCGACAAGCGCAGTGATGCGTCTGAGCTGGCGCGATGCAACCCGGACATGGCCAGTCGGTACAAGAGCCTGCTG
GACGAGGTCAACAAGCCCCTGGAGGGCCTCGAGCAGGGTCCGAACCGAAGACGCGAGGCGGCGGCGGCGCTGGAC
GCGTGCATACGAGAGATTAGGTCTCTCGCCGGCCACGAACGCTTTCTCCTGGGCTTGACGACTGCCGAAATGCAA
GAGTGCGCCTCGGGAGGCAGCATAGTTGTCGTGAACATTACCTACATTCGGAGCGATGCCATTATTGTCTCCCCG
GGGGGCATCAAGGCTTTGAAGCTTGCTGCCTTGTCGGCCTCCGATACGAGTGTCTGGCTGAACCAAGACTGGAGC
GGGCGTAGGTCGGAGCGCAGAGAGAAGAACATGCTCTATTCTCGCCATCTTGCCTGGCTGTGGGACGTCTGTGTC
GCACAGATCGTGCAAGAGGTTCGTGCCGCCCACGATCTGTTGGAGGGTTGTCTCCCGAGAGTGTGGTGGATCGGA
ACGGGCCTTGCATCCTCTCTGCCATTCCACGCCGCCGGCACTCACACCGTCGGCTCGGCGGAGAACGCTTATAGC
AAGGTCGTGTCGTCGTACACACCCTCCATCAAAGCGCTCGCATACTCTCAGAGTCGAGTGAGACGCGATCGAGGG
ACGCGGCAATCACTACTCATAGCAAGCATGCCGACGACGCCGGGCCTGCGCAAGCTTCCAGGCGTCATCGAAGAG
ACGGGGCGAGTATCGCAAGTCGCAGACGGCCACGGCCTCGCCATCGAGCTGCTCGAGAATCCCTCGGTGGAGAGC
GTCGTCGAGGGCCTACAGCGCTGCTCCATCGCGCACTTCGCCTGCCACGGGTCGACGGACCACCGGGATCCGTCC
AACAGCGGGCTGGTGTTCCAGAAGAGCGCGGCGGAACACGACAGACTCAGCGTTTACCGTATCTCAGACCTCAGC
CAGGAGCAGGCGCGGCTGGCATACCTATCGGCATGCTCGACGGCGGAGAACAAGGCGGCGCGGCTGACGGACGAG
GTGATTCACATTGTCAGCGGGTTGCAGGTGGCGGGCTTTCCCCATGCCGTCGGCTGCCTGTGGCCGTCGGTCGAC
CGAGTTTGCGTCGAGGTGGCCAGACGCTTCTACTCGTCCTTCCTCGGGAGGGAGGGACTCGGATGGCGCGATGGA
GCCGTGGCACGGTCGCTGAGAGAGGCCGTCGTGGCTGTCAGAAGCGACGACTATGACATGCCCCTGAACTGGGCG
CAGTTTGTTCACTACGGGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail