Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9441
Gene name
LocationContig_688:8464..10390
Strand-
Gene length (bp)1926
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.2E-40 72 459
PF00083 Sugar_tr Sugar (and other) transporter 7.0E-15 87 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 71 544 1.0E-77
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 43 538 1.0E-60
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 93 534 2.0E-44
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 63 543 5.0E-44
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 63 533 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 71 544 1.0E-77
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 43 538 1.0E-60
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 93 534 2.0E-44
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 63 543 5.0E-44
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 63 533 4.0E-39
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 51 475 3.0E-38
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 48 468 4.0E-37
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 51 483 1.0E-35
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 69 475 3.0E-34
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 53 481 3.0E-33
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 53 481 3.0E-33
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 52 497 3.0E-28
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 60 487 2.0E-24
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 60 485 1.0E-23
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 60 485 1.0E-23
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 71 293 2.0E-20
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 60 439 2.0E-18
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 63 513 8.0E-18
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 66 460 8.0E-17
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 50 378 9.0E-16
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 66 459 1.0E-15
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 64 378 3.0E-15
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 66 472 3.0E-15
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 66 472 3.0E-15
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 50 378 5.0E-15
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 66 460 1.0E-14
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 66 460 1.0E-14
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 66 460 1.0E-14
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 90 323 1.0E-14
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 66 460 3.0E-14
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 63 413 4.0E-14
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 63 462 5.0E-14
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 71 218 8.0E-14
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 60 467 1.0E-13
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 60 467 1.0E-13
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 50 497 1.0E-13
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 61 470 2.0E-13
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 58 358 3.0E-13
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 66 460 3.0E-13
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 48 363 5.0E-13
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 61 491 8.0E-13
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 81 266 2.0E-12
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 61 363 4.0E-12
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 106 546 7.0E-12
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 61 363 9.0E-12
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 50 259 1.0E-11
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 50 259 1.0E-11
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 52 496 1.0E-11
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 52 496 1.0E-11
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 52 496 1.0E-11
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 48 361 1.0E-11
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 48 361 1.0E-11
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 48 361 1.0E-11
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 48 361 1.0E-11
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 48 361 1.0E-11
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 48 361 1.0E-11
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 48 361 1.0E-11
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 48 361 1.0E-11
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 60 370 2.0E-11
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 60 370 2.0E-11
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 66 460 2.0E-11
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 52 496 2.0E-11
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 52 496 2.0E-11
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 52 496 3.0E-11
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 52 496 3.0E-11
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 52 496 3.0E-11
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 52 496 3.0E-11
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 63 360 5.0E-11
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 52 496 7.0E-11
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 51 459 9.0E-11
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 81 400 9.0E-11
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 81 400 9.0E-11
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 81 400 9.0E-11
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 81 400 9.0E-11
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 81 400 9.0E-11
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 81 400 9.0E-11
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 81 400 9.0E-11
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 81 400 9.0E-11
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 51 363 9.0E-11
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 48 361 9.0E-11
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 52 496 9.0E-11
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 6 482 2.0E-10
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 63 376 4.0E-10
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 56 378 4.0E-10
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 61 361 4.0E-10
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 65 398 5.0E-10
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 66 358 5.0E-10
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 72 405 1.0E-09
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 64 378 2.0E-09
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 65 458 2.0E-09
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 92 251 3.0E-09
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 61 361 3.0E-09
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 92 251 4.0E-09
sp|Q323D8|MDTD_SHIBS Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtD PE=3 SV=1 51 459 5.0E-09
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 112 537 5.0E-09
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 66 464 5.0E-09
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 51 409 7.0E-09
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 51 459 8.0E-09
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 51 459 8.0E-09
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 51 459 8.0E-09
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 51 459 8.0E-09
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 51 459 8.0E-09
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 51 459 8.0E-09
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 51 459 8.0E-09
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 51 459 1.0E-08
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 51 459 2.0E-08
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 51 459 2.0E-08
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 51 459 2.0E-08
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 51 459 2.0E-08
sp|Q0T353|MDTD_SHIF8 Putative multidrug resistance protein MdtD OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtD PE=3 SV=2 51 459 2.0E-08
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 51 459 2.0E-08
sp|A7ZNQ0|MDTD_ECO24 Putative multidrug resistance protein MdtD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtD PE=3 SV=1 51 363 2.0E-08
sp|B7NQA9|MDTD_ECO7I Putative multidrug resistance protein MdtD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtD PE=3 SV=1 51 459 2.0E-08
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 51 459 3.0E-08
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 51 459 3.0E-08
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 52 459 3.0E-08
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 51 459 3.0E-08
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 111 217 4.0E-08
sp|Q8FG02|MDTD_ECOL6 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtD PE=3 SV=1 51 459 4.0E-08
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 51 459 4.0E-08
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 51 459 4.0E-08
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 51 459 6.0E-08
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 109 217 9.0E-08
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 51 459 1.0E-07
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 60 358 1.0E-07
sp|Q6NMN6|SPNS1_ARATH Probable sphingolipid transporter spinster homolog 1 OS=Arabidopsis thaliana GN=At5g65687 PE=1 SV=1 95 239 2.0E-07
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 108 216 5.0E-07
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 107 538 1.0E-06
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 94 231 2.0E-06
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 108 212 2.0E-06
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 65 212 2.0E-06
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 48 235 2.0E-06
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 106 479 3.0E-06
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 112 546 3.0E-06
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 106 479 3.0E-06
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 94 210 4.0E-06
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 108 216 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 122 139 17
3 146 168 22
4 206 228 22
5 249 268 19
6 272 294 22
7 315 337 22
8 352 374 22
9 381 403 22
10 413 435 22
11 448 470 22
12 517 539 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9441
MAATHDGAPAAEAEAPTEASPLLAAARKHLDRSSAGHGHGSTLAHGGQAMATKMHLFIPAVGVGIYLVAVDQLLT
VAAYAKIGNELNSLNNMSWVATSFFLTLTSSQPLYGKLSDVFGRKECLLFSYAVFAVGCLGCGLARDIVQLCVSR
AVAGIGGGGMNAVVSIILSDLVPLRERGVWQGYLNVIYAAGSSTGAPVGGLFADSIGWRWSFLAQVPLCCVAWLA
VYCFLDMPHRADSDWRANMRKVDFLGASTLVAAVLALLVGLDFGSNFGWCHLATVVCLAAAPVLFALLVFVEARV
ATHPFAPAHVIFDRGLIAGYLTNFFGVGSYFAVLFFLPLSFQAGEGFNAATSGALLVPGMVAGVSASVTGGWLIK
RTGKFYAVTILSYGVLAFSILPLALSVWLEATAAEVMTFVLVAIGSGSGLTTTLTGLLANAATEDTAVVVACSYL
FRSLGSSIAISLSSAALQQVLRAQLASRLPSSEDARLIEERVRQNIDCIKSLPPPVASAVRASYRVATIGALAPA
LLMAVVALLATFWVRKKTLAS*
Coding >Hirsu2|9441
ATGGCGGCCACGCATGACGGAGCTCCCGCCGCCGAGGCCGAGGCCCCGACCGAAGCCTCGCCTCTCCTGGCGGCC
GCCAGGAAGCACCTCGACCGCTCCTCGGCTGGACACGGCCATGGCTCGACGCTCGCCCACGGCGGCCAAGCCATG
GCCACCAAGATGCATCTCTTCATACCCGCCGTCGGCGTCGGGATCTATCTCGTAGCCGTCGACCAGCTCCTGACC
GTGGCCGCCTACGCCAAGATAGGCAACGAGCTCAACTCGCTCAACAACATGAGCTGGGTCGCCACCTCCTTCTTC
CTCACCCTCACCAGTTCCCAGCCGCTCTACGGCAAGCTCAGCGACGTCTTCGGCCGCAAGGAATGTCTCCTCTTC
TCCTACGCCGTCTTTGCCGTCGGCTGCCTCGGCTGCGGCCTCGCCCGGGACATCGTCCAGCTGTGCGTCTCTCGC
GCCGTCGCCGGCATCGGCGGCGGCGGCATGAACGCCGTCGTCTCCATCATCTTGTCCGACCTCGTACCCCTGAGA
GAGCGCGGCGTCTGGCAGGGCTACCTCAACGTCATATATGCCGCCGGATCGTCCACTGGCGCGCCCGTCGGCGGC
CTGTTTGCCGATTCCATCGGCTGGCGATGGTCTTTCCTTGCTCAAGTGCCGCTTTGTTGTGTCGCCTGGCTCGCC
GTCTACTGCTTTCTCGACATGCCGCACCGCGCAGACTCGGACTGGCGCGCCAACATGCGCAAGGTCGACTTCCTC
GGCGCCTCGACCCTCGTCGCCGCCGTCCTTGCCCTCCTCGTCGGCCTCGACTTCGGCTCCAACTTTGGCTGGTGT
CATCTGGCGACCGTGGTCTGCCTTGCCGCCGCGCCCGTGCTCTTCGCGCTGCTCGTCTTCGTCGAGGCCAGGGTC
GCCACCCACCCGTTCGCCCCGGCTCATGTCATCTTCGATCGTGGCCTCATCGCCGGCTACCTCACCAACTTCTTC
GGCGTCGGCAGCTACTTTGCCGTCCTCTTCTTCCTTCCCTTGTCTTTCCAGGCCGGCGAAGGCTTCAATGCGGCG
ACCAGTGGCGCGCTGCTCGTGCCCGGCATGGTGGCCGGTGTCTCCGCCTCCGTCACCGGCGGCTGGCTCATCAAA
AGGACGGGCAAGTTCTATGCCGTCACCATCCTCAGCTACGGCGTCCTGGCCTTTAGCATTCTTCCCCTGGCCCTC
TCGGTATGGCTCGAGGCCACTGCTGCAGAGGTCATGACCTTTGTCCTTGTCGCGATAGGGAGTGGCTCCGGCCTC
ACCACCACGCTCACCGGGCTTCTGGCCAACGCCGCCACCGAGGACACGGCCGTCGTCGTCGCCTGTTCCTACCTC
TTCCGCTCGCTCGGCAGCAGCATCGCCATCTCCCTGAGCTCCGCCGCCCTCCAGCAGGTGTTGCGCGCACAGCTC
GCCTCCCGCCTGCCCAGCAGCGAAGATGCCCGTCTCATTGAGGAGAGGGTCCGGCAGAACATCGACTGCATCAAA
AGCCTGCCGCCGCCCGTCGCCAGCGCCGTCCGAGCCTCCTATCGTGTGGCCACGATCGGGGCCTTGGCACCGGCT
TTGCTGATGGCTGTCGTCGCTCTGTTGGCTACATTTTGGGTGAGGAAGAAGACTCTTGCGAGTTAG
Transcript >Hirsu2|9441
ATGGCGGCCACGCATGACGGAGCTCCCGCCGCCGAGGCCGAGGCCCCGACCGAAGCCTCGCCTCTCCTGGCGGCC
GCCAGGAAGCACCTCGACCGCTCCTCGGCTGGACACGGCCATGGCTCGACGCTCGCCCACGGCGGCCAAGCCATG
GCCACCAAGATGCATCTCTTCATACCCGCCGTCGGCGTCGGGATCTATCTCGTAGCCGTCGACCAGCTCCTGACC
GTGGCCGCCTACGCCAAGATAGGCAACGAGCTCAACTCGCTCAACAACATGAGCTGGGTCGCCACCTCCTTCTTC
CTCACCCTCACCAGTTCCCAGCCGCTCTACGGCAAGCTCAGCGACGTCTTCGGCCGCAAGGAATGTCTCCTCTTC
TCCTACGCCGTCTTTGCCGTCGGCTGCCTCGGCTGCGGCCTCGCCCGGGACATCGTCCAGCTGTGCGTCTCTCGC
GCCGTCGCCGGCATCGGCGGCGGCGGCATGAACGCCGTCGTCTCCATCATCTTGTCCGACCTCGTACCCCTGAGA
GAGCGCGGCGTCTGGCAGGGCTACCTCAACGTCATATATGCCGCCGGATCGTCCACTGGCGCGCCCGTCGGCGGC
CTGTTTGCCGATTCCATCGGCTGGCGATGGTCTTTCCTTGCTCAAGTGCCGCTTTGTTGTGTCGCCTGGCTCGCC
GTCTACTGCTTTCTCGACATGCCGCACCGCGCAGACTCGGACTGGCGCGCCAACATGCGCAAGGTCGACTTCCTC
GGCGCCTCGACCCTCGTCGCCGCCGTCCTTGCCCTCCTCGTCGGCCTCGACTTCGGCTCCAACTTTGGCTGGTGT
CATCTGGCGACCGTGGTCTGCCTTGCCGCCGCGCCCGTGCTCTTCGCGCTGCTCGTCTTCGTCGAGGCCAGGGTC
GCCACCCACCCGTTCGCCCCGGCTCATGTCATCTTCGATCGTGGCCTCATCGCCGGCTACCTCACCAACTTCTTC
GGCGTCGGCAGCTACTTTGCCGTCCTCTTCTTCCTTCCCTTGTCTTTCCAGGCCGGCGAAGGCTTCAATGCGGCG
ACCAGTGGCGCGCTGCTCGTGCCCGGCATGGTGGCCGGTGTCTCCGCCTCCGTCACCGGCGGCTGGCTCATCAAA
AGGACGGGCAAGTTCTATGCCGTCACCATCCTCAGCTACGGCGTCCTGGCCTTTAGCATTCTTCCCCTGGCCCTC
TCGGTATGGCTCGAGGCCACTGCTGCAGAGGTCATGACCTTTGTCCTTGTCGCGATAGGGAGTGGCTCCGGCCTC
ACCACCACGCTCACCGGGCTTCTGGCCAACGCCGCCACCGAGGACACGGCCGTCGTCGTCGCCTGTTCCTACCTC
TTCCGCTCGCTCGGCAGCAGCATCGCCATCTCCCTGAGCTCCGCCGCCCTCCAGCAGGTGTTGCGCGCACAGCTC
GCCTCCCGCCTGCCCAGCAGCGAAGATGCCCGTCTCATTGAGGAGAGGGTCCGGCAGAACATCGACTGCATCAAA
AGCCTGCCGCCGCCCGTCGCCAGCGCCGTCCGAGCCTCCTATCGTGTGGCCACGATCGGGGCCTTGGCACCGGCT
TTGCTGATGGCTGTCGTCGCTCTGTTGGCTACATTTTGGGTGAGGAAGAAGACTCTTGCGAGTTAG
Gene >Hirsu2|9441
ATGGCGGCCACGCATGACGGAGCTCCCGCCGCCGAGGCCGAGGCCCCGACCGAAGCCTCGCCTCTCCTGGCGGCC
GCCAGGAAGCACCTCGACCGCTCCTCGGCTGGACACGGCCATGGCTCGACGCTCGCCCACGGCGGCCAAGCCATG
GCCACCAAGATGCATCTCTTCATACCCGCCGTCGGCGTCGGGGTCCGTCTTCCGCTCTCGAAAACACCGCGTCCG
CGAGACTGACGGCGTTTGTGACGATTCTCAAGATCTATCTCGTAGCCGTCGACCAGCTCCTGACCGTGGCCGCCT
ACGCCAAGATAGGCAACGAGCTCAACTCGCTCAACAACATGAGCTGGGTCGCCACCTCGTGAGTCTGCCCCCTTG
GTCCCCGCGCCGGGGCACGCAGCGCATGGACGATTCGCCCCGAGGTCCCGACACTCACTTCTTCTCCTCCTTCTC
CCGCCAGCTTCTTCCTCACCCTCACCAGTTCCCAGCCGCTCTACGGCAAGCTCAGCGACGTCTTCGGCCGCAAGG
AATGTCTCCTCTTCTCCTACGCCGTCTTTGCCGTCGGCTGCCTCGGCTGCGGCCTCGCCCGGGACATCGTCCAGC
TGTGCGTCTCTCGCGCCGTCGCCGGCATCGGCGGCGGCGGCATGAACGCCGTCGTCTCCATCATCTTGTCCGACC
TCGTACCCCTGAGAGAGCGCGGCGTCTGGCAGGGCTACCTCAACGTCATATATGCCGCCGGATCGTCCACTGGCG
CGCCCGTCGGCGGCCTGTTTGCCGATTCCATCGGCTGGCGATGGTGAACCCTGTCCTTTCCCTTTCACTCGACCG
GGCCCTTGTTGCTGACGACTCGGTGAATAGGTCTTTCCTTGCTCAAGTGCCGCTTTGTTGTGTCGCCTGGCTCGC
CGTCTACTGCTTTCTCGACATGCCGCACCGCGCAGACTCGGACTGGCGCGCCAACATGCGCAAGGTCGACTTCCT
CGGCGCCTCGACCCTCGTCGCCGCCGTCCTTGCCCTCCTCGTCGGCCTCGACTTCGGCTCCAACTTTGGCTGGTG
TCATCTGGCGACCGTGGTCTGCCTTGCCGCCGCGCCCGTGCTCTTCGCGCTGCTCGTCTTCGTCGAGGCCAGGGT
CGCCACCCACCCGTTCGCCCCGGCTCATGTCATCTTCGATCGTGGCCTCATCGCCGGCTACCTCACCAACTTCTT
CGGCGTCGGCAGCTACTTTGCCGTCCTCTTCTTCCTTCCCTTGTCTTTCCAGGCCGGCGAAGGCTTCAATGCGGC
GACCAGTGGCGCGCTGCTCGTGCCCGGCATGGTGGCCGGTGTCTCCGCCTCCGTCACCGGCGGCTGGCTCATCAA
AAGGACGGGCAAGTTCTATGCCGTCACCATCCTCAGCTACGGCGTCCTGGCCTTTAGCATTCTTCCCCTGGCCCT
CTCGGTATGGCTCGAGGCCACTGCTGCAGAGGTCATGACCTTTGTCCTTGTCGCGATAGGGAGTGGCTCCGGTAA
GAGTCCCTTCCATCGATGCCTCGCGAAACGTCGTGGCTCACAAACGGATTCTCAGGCCTCACCACCACGCTCACC
GGGCTTCTGGCCAACGCCGCCACCGAGGACACGGCCGTCGTCGTCGCCTGTTCCTACCTCTTCCGCTCGCTCGGC
AGCAGCATCGCCATCTCCCTGAGCTCCGCCGCCCTCCAGCAGGTGTTGCGCGCACAGCTCGCCTCCCGCCTGCCC
AGCAGCGAAGATGCCCGTCTCATTGAGGAGAGGGTCCGGCAGAACATCGACTGCATCAAAAGCCTGCCGCCGCCC
GTCGCCAGCGCCGTCCGAGCCTCCTATCGTGTGGCCACGATCGGGGCCTTGGCACCGGCTTTGCTGATGGCTGTC
GTCGCTCTGTTGGCTACATTTTGGGTGAGGAAGAAGACTCTTGCGAGTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail