Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|944
Gene name
LocationContig_1199:4393..5169
Strand+
Gene length (bp)776
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.052 0.0797 0.8751 0.3764 0.0824 0.0035 0.1508 0.1004 0.1812 0.0051

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999706

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4518
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4609
Ophiocordyceps australis map64 (Brazil) OphauB2|5460
Ophiocordyceps camponoti-floridani Ophcf2|04650
Ophiocordyceps camponoti-rufipedis Ophun1|3820
Ophiocordyceps kimflemingae Ophio5|5344
Ophiocordyceps subramaniannii Hirsu2|944 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|944
MRASTALVVLSAAVASAQSTTTGNYTSELDMIKDFNAQSVQPSQRAVWCRAQTNTCGLLCDNNTNKNSCAQEDLK
FECTCASNNSAPGLQYYTQTVPTFICETLFSQCNSQQVGNADGQMGCLNNIQNLCGKAAPPKGGVSSDSKDGGDS
SSSSASSPQPTGSRGSSSSNGAVSSSTSGGLAAPTMAPAGKGAVAAAAFGLVVYIL*
Coding >Hirsu2|944
ATGCGCGCCTCTACCGCTCTCGTTGTCCTTTCGGCCGCCGTCGCCTCGGCTCAGTCGACGACGACGGGCAACTAC
ACCTCGGAGCTCGACATGATCAAGGACTTCAACGCCCAGTCGGTTCAGCCTAGCCAGCGAGCCGTCTGGTGCCGT
GCTCAGACCAACACGTGCGGCCTGCTCTGCGACAACAACACGAACAAGAACAGCTGTGCCCAGGAGGACCTCAAG
TTCGAGTGCACGTGCGCCAGCAACAACTCGGCCCCCGGCCTGCAGTACTACACGCAGACGGTGCCCACCTTCATC
TGTGAAACGCTCTTTAGCCAGTGCAACAGCCAGCAGGTCGGCAACGCAGACGGCCAGATGGGCTGCCTGAACAAT
ATTCAGAACCTCTGCGGCAAGGCGGCCCCGCCCAAGGGTGGCGTCAGCAGCGACTCCAAGGACGGCGGCGACAGC
TCGTCGTCGAGCGCATCGTCCCCGCAGCCCACGGGCTCGCGCGGCAGCTCCAGCAGCAACGGCGCCGTCTCGTCG
TCCACCTCGGGCGGCCTCGCCGCCCCCACCATGGCCCCCGCCGGCAAGGGTGCCGTCGCCGCCGCCGCCTTCGGC
CTCGTCGTCTACATTCTCTGA
Transcript >Hirsu2|944
ATGCGCGCCTCTACCGCTCTCGTTGTCCTTTCGGCCGCCGTCGCCTCGGCTCAGTCGACGACGACGGGCAACTAC
ACCTCGGAGCTCGACATGATCAAGGACTTCAACGCCCAGTCGGTTCAGCCTAGCCAGCGAGCCGTCTGGTGCCGT
GCTCAGACCAACACGTGCGGCCTGCTCTGCGACAACAACACGAACAAGAACAGCTGTGCCCAGGAGGACCTCAAG
TTCGAGTGCACGTGCGCCAGCAACAACTCGGCCCCCGGCCTGCAGTACTACACGCAGACGGTGCCCACCTTCATC
TGTGAAACGCTCTTTAGCCAGTGCAACAGCCAGCAGGTCGGCAACGCAGACGGCCAGATGGGCTGCCTGAACAAT
ATTCAGAACCTCTGCGGCAAGGCGGCCCCGCCCAAGGGTGGCGTCAGCAGCGACTCCAAGGACGGCGGCGACAGC
TCGTCGTCGAGCGCATCGTCCCCGCAGCCCACGGGCTCGCGCGGCAGCTCCAGCAGCAACGGCGCCGTCTCGTCG
TCCACCTCGGGCGGCCTCGCCGCCCCCACCATGGCCCCCGCCGGCAAGGGTGCCGTCGCCGCCGCCGCCTTCGGC
CTCGTCGTCTACATTCTCTGA
Gene >Hirsu2|944
ATGCGCGCCTCTACCGCTCTCGTTGTCCTTTCGGCCGCCGTCGCCTCGGCTCAGTCGACGACGACGGGCAACTAC
ACCTCGGAGCTCGACATGATCAAGGACTTCAACGCCCAGTCGGTTCAGCCTAGCCAGCGAGGTACGTATTGGGCC
CTCGCCGGCCACGGCCCAATCTTGCCGAGGCACCGCCCACCTGCTGACGACGCCTCTCTACACAGCCGTCTGGTG
CCGTGCTCAGACCAACACGTGCGGCCTGCTCTGCGACAACAACACGAACAAGAACAGCTGTGCCCAGGTAAGCTC
GCCTCGAGCCCACCAATCCCCGACCCCGTCGTCCATCCTCGTCCTCGCTTGCTGACTTGGCCCTTCAGGAGGACC
TCAAGTTCGAGTGCACGTGCGCCAGCAACAACTCGGCCCCCGGCCTGCAGTACTACACGCAGACGGTGCCCACCT
TCATCTGTGAAACGCTCTTTAGCCAGTGCAACAGCCAGCAGGTCGGCAACGCAGACGGCCAGATGGGCTGCCTGA
ACAATATTCAGAACCTCTGCGGCAAGGCGGCCCCGCCCAAGGGTGGCGTCAGCAGCGACTCCAAGGACGGCGGCG
ACAGCTCGTCGTCGAGCGCATCGTCCCCGCAGCCCACGGGCTCGCGCGGCAGCTCCAGCAGCAACGGCGCCGTCT
CGTCGTCCACCTCGGGCGGCCTCGCCGCCCCCACCATGGCCCCCGCCGGCAAGGGTGCCGTCGCCGCCGCCGCCT
TCGGCCTCGTCGTCTACATTCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail