Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9428
Gene name
LocationContig_685:7831..9490
Strand-
Gene length (bp)1659
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 5.9E-13 3 148
PF00743 FMO-like Flavin-binding monooxygenase-like 1.5E-07 321 494
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 1.8E-10 15 150
PF13434 K_oxygenase L-lysine 6-monooxygenase (NADPH-requiring) 2.3E-08 19 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 1 496 5.0E-14
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 295 496 1.0E-08
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 295 496 2.0E-08
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 14 133 8.0E-08
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 295 496 9.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 1 496 5.0E-14
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 295 496 1.0E-08
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 295 496 2.0E-08
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 14 133 8.0E-08
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 295 496 9.0E-08
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 323 496 1.0E-07
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 323 496 1.0E-07
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 1 148 2.0E-07
sp|Q9HFE4|FMO1_SCHPO Thiol-specific monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmo1 PE=1 SV=1 34 129 4.0E-07
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 1 158 5.0E-07
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 1 148 6.0E-07
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 14 133 7.0E-07
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 1 130 1.0E-06
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 1 130 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0016491 oxidoreductase activity No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0004497 monooxygenase activity No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9428
LTTFSDFRHGGCEDFLAPEQYVQYLGEYCTHFKLWPRILLVTRVLAVTRRQGGGHVVTYATGSGHGQSEWECDAV
AVCSGLHVEPNIPHISGIENVPLVFHSSLFKRRKQFGVDKTVMVVGSGETAADVAYLAVTSPTRRVVMCHRDGFH
LAPKRNPGPVLLPVLGRKPSSKEAGIPIDVSRANLFDTTYVHPLLRESMLLWDYYNWYIKALLWVSAGSTMGMDQ
WIGGVGHERHHPSKIFFNKSDKIGPYISLPYRPKHPGWGLWLYALRSALVQRPVLDTEGKQIDLAPWPEAIDGKG
FVRFRNNGRPEFERMSKERIKPDVVVLCTGYKQSFAFFQPCRSPKDRAYPVASDADVRGIWKRDEPTVGFIGFIR
PSFGAIPPLAEMQAQLWIVNLLAPRRIPRALVPEDEAHYRLLHPPASRISYGVDHESYTYQLALDLGSAPGVTDV
LRLVDCSLQAWKLVIIWAFGAHFNTKFRLQGPWEWHGARDLLVSREFWETITRRPLFFGQ*
Coding >Hirsu2|9428
CTGACGACCTTCTCGGACTTCAGACACGGCGGCTGCGAGGATTTCCTCGCCCCAGAGCAATATGTTCAGTACCTT
GGAGAATACTGCACACACTTCAAGCTGTGGCCTCGCATCCTTCTCGTCACCAGGGTGCTGGCCGTGACTCGAAGA
CAAGGAGGTGGGCACGTCGTCACATATGCGACTGGCAGCGGCCACGGACAGTCCGAGTGGGAGTGTGACGCTGTT
GCGGTGTGCTCGGGCCTGCATGTCGAGCCCAACATCCCCCACATCAGCGGCATCGAAAACGTGCCGCTCGTCTTC
CACTCTTCGCTGTTCAAGCGACGCAAGCAGTTCGGAGTCGACAAAACGGTCATGGTGGTTGGAAGTGGCGAGACG
GCTGCGGACGTGGCGTATCTGGCCGTCACATCGCCGACCAGACGTGTCGTCATGTGCCATAGGGATGGCTTCCAC
CTGGCGCCCAAGCGGAACCCCGGACCTGTCCTGTTGCCGGTCTTGGGGAGGAAGCCGAGCAGCAAGGAGGCGGGT
ATCCCGATCGACGTGAGCCGGGCGAACCTGTTCGACACCACATATGTCCACCCCCTTCTCCGCGAATCCATGCTG
CTGTGGGACTATTATAACTGGTACATCAAAGCGTTGTTGTGGGTGTCTGCCGGCTCCACGATGGGCATGGATCAA
TGGATCGGGGGCGTCGGCCACGAACGCCACCATCCATCCAAGATCTTCTTCAACAAGTCGGATAAGATCGGCCCG
TACATCAGCCTGCCGTATCGCCCAAAGCATCCCGGATGGGGCCTGTGGCTATACGCCTTGCGATCAGCGCTCGTC
CAACGGCCCGTCTTGGACACCGAGGGCAAGCAGATCGACCTGGCGCCGTGGCCGGAAGCAATAGACGGCAAGGGC
TTCGTACGTTTCCGAAACAACGGACGGCCCGAGTTCGAGCGGATGAGCAAGGAGAGGATCAAGCCCGATGTCGTC
GTTCTCTGCACCGGTTACAAGCAAAGCTTTGCCTTCTTTCAACCTTGCCGGAGCCCGAAGGATAGAGCGTATCCG
GTGGCGAGCGATGCCGACGTGCGTGGAATATGGAAGCGTGACGAGCCGACGGTCGGCTTCATCGGCTTCATCAGG
CCGTCCTTCGGCGCCATCCCGCCCCTGGCCGAGATGCAAGCCCAGCTGTGGATTGTGAACCTGCTTGCCCCCCGC
CGGATTCCACGAGCTCTCGTGCCGGAAGACGAGGCGCACTATCGCCTCCTTCACCCGCCGGCTTCCAGGATAAGC
TACGGCGTCGACCACGAGAGCTACACGTACCAGCTCGCGCTGGACCTGGGCTCGGCCCCGGGCGTCACGGACGTC
TTGCGGCTCGTCGACTGTAGCCTCCAAGCCTGGAAACTCGTCATCATCTGGGCGTTCGGGGCGCACTTCAACACC
AAGTTCCGGCTGCAGGGCCCCTGGGAATGGCACGGGGCACGCGACTTGCTCGTGTCGCGCGAGTTCTGGGAGACC
ATCACCCGTCGACCACTATTTTTCGGTCAGTAG
Transcript >Hirsu2|9428
CTGACGACCTTCTCGGACTTCAGACACGGCGGCTGCGAGGATTTCCTCGCCCCAGAGCAATATGTTCAGTACCTT
GGAGAATACTGCACACACTTCAAGCTGTGGCCTCGCATCCTTCTCGTCACCAGGGTGCTGGCCGTGACTCGAAGA
CAAGGAGGTGGGCACGTCGTCACATATGCGACTGGCAGCGGCCACGGACAGTCCGAGTGGGAGTGTGACGCTGTT
GCGGTGTGCTCGGGCCTGCATGTCGAGCCCAACATCCCCCACATCAGCGGCATCGAAAACGTGCCGCTCGTCTTC
CACTCTTCGCTGTTCAAGCGACGCAAGCAGTTCGGAGTCGACAAAACGGTCATGGTGGTTGGAAGTGGCGAGACG
GCTGCGGACGTGGCGTATCTGGCCGTCACATCGCCGACCAGACGTGTCGTCATGTGCCATAGGGATGGCTTCCAC
CTGGCGCCCAAGCGGAACCCCGGACCTGTCCTGTTGCCGGTCTTGGGGAGGAAGCCGAGCAGCAAGGAGGCGGGT
ATCCCGATCGACGTGAGCCGGGCGAACCTGTTCGACACCACATATGTCCACCCCCTTCTCCGCGAATCCATGCTG
CTGTGGGACTATTATAACTGGTACATCAAAGCGTTGTTGTGGGTGTCTGCCGGCTCCACGATGGGCATGGATCAA
TGGATCGGGGGCGTCGGCCACGAACGCCACCATCCATCCAAGATCTTCTTCAACAAGTCGGATAAGATCGGCCCG
TACATCAGCCTGCCGTATCGCCCAAAGCATCCCGGATGGGGCCTGTGGCTATACGCCTTGCGATCAGCGCTCGTC
CAACGGCCCGTCTTGGACACCGAGGGCAAGCAGATCGACCTGGCGCCGTGGCCGGAAGCAATAGACGGCAAGGGC
TTCGTACGTTTCCGAAACAACGGACGGCCCGAGTTCGAGCGGATGAGCAAGGAGAGGATCAAGCCCGATGTCGTC
GTTCTCTGCACCGGTTACAAGCAAAGCTTTGCCTTCTTTCAACCTTGCCGGAGCCCGAAGGATAGAGCGTATCCG
GTGGCGAGCGATGCCGACGTGCGTGGAATATGGAAGCGTGACGAGCCGACGGTCGGCTTCATCGGCTTCATCAGG
CCGTCCTTCGGCGCCATCCCGCCCCTGGCCGAGATGCAAGCCCAGCTGTGGATTGTGAACCTGCTTGCCCCCCGC
CGGATTCCACGAGCTCTCGTGCCGGAAGACGAGGCGCACTATCGCCTCCTTCACCCGCCGGCTTCCAGGATAAGC
TACGGCGTCGACCACGAGAGCTACACGTACCAGCTCGCGCTGGACCTGGGCTCGGCCCCGGGCGTCACGGACGTC
TTGCGGCTCGTCGACTGTAGCCTCCAAGCCTGGAAACTCGTCATCATCTGGGCGTTCGGGGCGCACTTCAACACC
AAGTTCCGGCTGCAGGGCCCCTGGGAATGGCACGGGGCACGCGACTTGCTCGTGTCGCGCGAGTTCTGGGAGACC
ATCACCCGTCGACCACTATTTTTCGGTCAGTAG
Gene >Hirsu2|9428
CTGACGACCTTCTCGGACTTCAGACACGGCGGCTGCGAGGATTTCCTCGCCCCAGAGCAATATGTTCAGTACCTT
GGAGAATACTGCACACACTTCAAGCTGTGGCCTCGCATCCTTCTCGTCACCAGGGTGCTGGCCGTGACTCGAAGA
CAAGGAGGTGGGCACGTCGTCACATATGCGACTGGCAGCGGCCACGGACAGTCCGAGTGGGAGTGTGACGCTGTT
GCGGTGTGCTCGGGCCTGCATGTCGAGCCCAACATCCCCCACATCAGCGGCATCGAAAACGTGCCGCTCGTCTTC
CACTCTTCGCTGTTCAAGCGACGCAAGCAGTTCGGAGTCGACAAAACGGTCATGGTGGTTGGAAGTGGCGAGACG
GCTGCGGACGTGGCGTATCTGGCCGTCACATCGCCGACCAGACGTGTCGTCATGTGCCATAGGGATGGCTTCCAC
CTGGCGCCCAAGGTTCGTGTGCCCTCAACCGCCCTCTACCTCCGCCCACGGGCCGGGAGCTGACGTCCGGCCTTC
GGGTGTCAGCGGAACCCCGGACCTGTCCTGTTGCCGGTCTTGGGGAGGAAGCCGAGCAGCAAGGAGGCGGGTATC
CCGATCGACGTGAGCCGGGCGAACCTGTTCGACACCACATATGTCCACCCCCTTCTCCGCGAATCCATGCTGCTG
TGGGACTATTATAACTGGTACATCAAAGCGTTGTTGTGGGTGTCTGCCGGCTCCACGATGGGCATGGATCAATGG
ATCGGGGGCGTCGGCCACGAACGCCACCATCCATCCAAGAGTAGGTCGGCCACGTTCCACAAAACGTGGGAGGTC
AGACACTCACCTCGGGCAGTCTTCTTCAACAAGTCGGATAAGATCGGCCCGTACATCAGCCTGCCGTATCGCCCA
AAGCATCCCGGATGGGGCCTGTGGCTATACGCCTTGCGATCAGCGCTCGTCCAACGGCCCGTCTTGGACACCGAG
GGCAAGCAGATCGACCTGGCGCCGTGGCCGGAAGCAATAGACGGCAAGGGCTTCGTACGTTTCCGAAACAACGGA
CGGCCCGAGTTCGAGCGGATGAGCAAGGAGAGGATCAAGCCCGATGTCGTCGTTCTCTGCACCGGTTACAAGCAA
AGCTTTGCCTTCTTTCAACCTTGCCGGAGCCCGAAGGATAGAGCGTATCCGGTGGCGAGCGATGCCGACGTGCGT
GGAATATGGAAGCGTGACGAGCCGACGGTCGGCTTCATCGGCTTCATCAGGCCGTCCTTCGGCGCCATCCCGCCC
CTGGCCGAGATGCAAGCCCAGCTGTGGATTGTGAACCTGCTTGCCCCCCGCCGGATTCCACGAGCTCTCGTGCCG
GAAGACGAGGCGCACTATCGCCTCCTTCACCCGCCGGCTTCCAGGATAAGCTACGGCGTCGACCACGAGAGCTAC
ACGTACCAGCTCGCGCTGGACCTGGGCTCGGCCCCGGGCGTCACGGACGTCTTGCGGCTCGTCGACTGTAGCCTC
CAAGCCTGGAAACTCGTCATCATCTGGGCGTTCGGGGCGCACTTCAACACCAAGTTCCGGCTGCAGGGCCCCTGG
GAATGGCACGGGGCACGCGACTTGCTCGTGTCGCGCGAGTTCTGGGAGACCATCACCCGTCGACCACTATTTTTC
GGTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail