Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9426
Gene name
LocationContig_685:3407..5012
Strand+
Gene length (bp)1605
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13415 Kelch_3 Galactose oxidase, central domain 5.2E-06 282 320
PF13964 Kelch_6 Kelch motif 1.1E-06 157 205
PF13418 Kelch_4 Galactose oxidase, central domain 3.9E-04 157 203
PF13418 Kelch_4 Galactose oxidase, central domain 6.7E-06 281 316
PF01344 Kelch_1 Kelch motif 4.5E-06 157 203
PF13854 Kelch_5 Kelch motif 2.6E-05 154 195

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9426
MEPLIKLKRRSTGLFNQVQQSLPSLPRFHTHSRLHQDVIKGTWEPIDVPFLPRSLHSLDVVAGSAYIFGGEINPR
EPVDNDMHIVRLPFSGASADYYKIEAKAALPESLESRDESPGEETGQRDLDDVPLEGDALDKGKGPAAAEEELPE
LGHVPCARVGHATAVIGSRIFLFGGRGGRDMAPLDEAGRVWVFDTRSCTWSHLDPVSAVSGDAVIPHPEPRSYHC
ATAIDLPRDFARPRPRKPQTWRQWAVGDSARTGIPQNPIVGNVAEDAVDHESEGYGTFFIHAGCLASGDRTSELW
AFDINSRTWTELPAAPGPCREGTAICVSKSRLFRFGGYDGAQELGGQIDFLPLELEMFDDRTTKGEVSVYARPGG
WKTIVADDQNASSTDIPAEASQDWPAPRSFGSMQALTLGGGREYLVLIMGERVPSPEGHDGAGIFLNDVWVFQVP
PLGMTTASFKDAMLQAVGRKTGEGRWTKVSTAPYDDATDGEPTSRGWLASAPLGDVDEGGLVIWGGLGEDNNRIG
DGWILRLRT*
Coding >Hirsu2|9426
ATGGAGCCCTTGATAAAGCTCAAGCGCCGGTCCACCGGCCTGTTCAACCAAGTCCAACAGAGCCTCCCCTCACTG
CCACGCTTCCACACGCATTCGCGCCTCCACCAGGATGTCATCAAGGGCACCTGGGAGCCCATCGACGTACCGTTC
CTGCCGCGATCCTTGCACTCACTCGACGTCGTTGCCGGCTCCGCGTACATCTTTGGAGGCGAGATCAACCCCCGC
GAACCCGTCGACAATGACATGCACATCGTCCGGCTACCCTTCAGCGGTGCCAGCGCCGATTATTACAAGATCGAG
GCAAAGGCAGCCCTGCCAGAGTCGCTGGAGTCACGAGACGAAAGCCCGGGGGAGGAGACGGGTCAACGAGATTTG
GACGACGTACCGCTCGAGGGCGATGCGCTGGATAAGGGTAAGGGGCCAGCAGCAGCCGAGGAGGAGCTGCCTGAG
CTCGGACACGTACCATGTGCCCGTGTCGGCCACGCAACCGCCGTCATCGGCTCACGCATATTCTTGTTCGGCGGT
CGCGGCGGACGGGACATGGCGCCTCTGGACGAGGCAGGCCGCGTCTGGGTCTTCGACACGCGTTCTTGTACTTGG
TCGCACCTCGATCCCGTCTCGGCCGTCAGTGGCGACGCCGTCATTCCTCATCCGGAACCTCGCAGCTATCACTGC
GCAACCGCAATAGACCTTCCCCGCGACTTCGCCCGGCCGCGCCCTCGCAAGCCGCAGACTTGGCGGCAGTGGGCG
GTCGGAGACTCGGCCCGGACCGGCATCCCCCAGAACCCCATCGTCGGCAACGTCGCCGAAGACGCCGTCGACCAC
GAGTCGGAAGGTTACGGAACCTTTTTCATTCACGCAGGATGCCTTGCCAGCGGGGACCGCACCAGCGAGCTCTGG
GCCTTTGACATCAACTCTCGCACCTGGACAGAGCTCCCGGCCGCTCCCGGCCCGTGCCGTGAGGGGACTGCCATA
TGCGTCAGCAAGAGCCGACTCTTCCGCTTCGGCGGCTACGACGGCGCGCAAGAACTCGGCGGCCAGATCGACTTC
CTTCCTCTCGAGCTCGAGATGTTCGACGACCGCACGACCAAGGGAGAAGTCTCCGTCTACGCCCGCCCCGGCGGA
TGGAAGACGATCGTCGCCGACGACCAAAACGCCTCGTCCACCGACATCCCTGCCGAGGCCTCGCAGGACTGGCCC
GCCCCGCGCAGCTTCGGCTCCATGCAGGCGCTCACCCTCGGCGGCGGCCGCGAGTACCTCGTCCTCATCATGGGC
GAGCGCGTCCCAAGCCCCGAGGGCCACGACGGCGCCGGCATCTTCCTCAACGATGTCTGGGTCTTCCAGGTCCCG
CCGCTGGGCATGACAACGGCCAGCTTCAAGGACGCCATGCTGCAGGCCGTGGGCAGGAAGACGGGCGAAGGCAGG
TGGACCAAGGTATCGACGGCGCCCTACGACGACGCGACGGACGGTGAGCCGACCTCGAGGGGGTGGCTGGCGAGC
GCGCCCCTGGGCGACGTCGACGAGGGCGGGCTTGTGATTTGGGGCGGACTCGGAGAAGACAACAACCGCATCGGC
GACGGCTGGATCCTTAGGCTCAGGACGTGA
Transcript >Hirsu2|9426
ATGGAGCCCTTGATAAAGCTCAAGCGCCGGTCCACCGGCCTGTTCAACCAAGTCCAACAGAGCCTCCCCTCACTG
CCACGCTTCCACACGCATTCGCGCCTCCACCAGGATGTCATCAAGGGCACCTGGGAGCCCATCGACGTACCGTTC
CTGCCGCGATCCTTGCACTCACTCGACGTCGTTGCCGGCTCCGCGTACATCTTTGGAGGCGAGATCAACCCCCGC
GAACCCGTCGACAATGACATGCACATCGTCCGGCTACCCTTCAGCGGTGCCAGCGCCGATTATTACAAGATCGAG
GCAAAGGCAGCCCTGCCAGAGTCGCTGGAGTCACGAGACGAAAGCCCGGGGGAGGAGACGGGTCAACGAGATTTG
GACGACGTACCGCTCGAGGGCGATGCGCTGGATAAGGGTAAGGGGCCAGCAGCAGCCGAGGAGGAGCTGCCTGAG
CTCGGACACGTACCATGTGCCCGTGTCGGCCACGCAACCGCCGTCATCGGCTCACGCATATTCTTGTTCGGCGGT
CGCGGCGGACGGGACATGGCGCCTCTGGACGAGGCAGGCCGCGTCTGGGTCTTCGACACGCGTTCTTGTACTTGG
TCGCACCTCGATCCCGTCTCGGCCGTCAGTGGCGACGCCGTCATTCCTCATCCGGAACCTCGCAGCTATCACTGC
GCAACCGCAATAGACCTTCCCCGCGACTTCGCCCGGCCGCGCCCTCGCAAGCCGCAGACTTGGCGGCAGTGGGCG
GTCGGAGACTCGGCCCGGACCGGCATCCCCCAGAACCCCATCGTCGGCAACGTCGCCGAAGACGCCGTCGACCAC
GAGTCGGAAGGTTACGGAACCTTTTTCATTCACGCAGGATGCCTTGCCAGCGGGGACCGCACCAGCGAGCTCTGG
GCCTTTGACATCAACTCTCGCACCTGGACAGAGCTCCCGGCCGCTCCCGGCCCGTGCCGTGAGGGGACTGCCATA
TGCGTCAGCAAGAGCCGACTCTTCCGCTTCGGCGGCTACGACGGCGCGCAAGAACTCGGCGGCCAGATCGACTTC
CTTCCTCTCGAGCTCGAGATGTTCGACGACCGCACGACCAAGGGAGAAGTCTCCGTCTACGCCCGCCCCGGCGGA
TGGAAGACGATCGTCGCCGACGACCAAAACGCCTCGTCCACCGACATCCCTGCCGAGGCCTCGCAGGACTGGCCC
GCCCCGCGCAGCTTCGGCTCCATGCAGGCGCTCACCCTCGGCGGCGGCCGCGAGTACCTCGTCCTCATCATGGGC
GAGCGCGTCCCAAGCCCCGAGGGCCACGACGGCGCCGGCATCTTCCTCAACGATGTCTGGGTCTTCCAGGTCCCG
CCGCTGGGCATGACAACGGCCAGCTTCAAGGACGCCATGCTGCAGGCCGTGGGCAGGAAGACGGGCGAAGGCAGG
TGGACCAAGGTATCGACGGCGCCCTACGACGACGCGACGGACGGTGAGCCGACCTCGAGGGGGTGGCTGGCGAGC
GCGCCCCTGGGCGACGTCGACGAGGGCGGGCTTGTGATTTGGGGCGGACTCGGAGAAGACAACAACCGCATCGGC
GACGGCTGGATCCTTAGGCTCAGGACGTGA
Gene >Hirsu2|9426
ATGGAGCCCTTGATAAAGCTCAAGCGCCGGTCCACCGGCCTGTTCAACCAAGTCCAACAGAGCCTCCCCTCACTG
CCACGCTTCCACACGCATTCGCGCCTCCACCAGGATGTCATCAAGGGCACCTGGGAGCCCATCGACGTACCGTTC
CTGCCGCGATCCTTGCACTCACTCGACGTCGTTGCCGGCTCCGCGTACATCTTTGGAGGCGAGATCAACCCCCGC
GAACCCGTCGACAATGACATGCACATCGTCCGGCTACCCTTCAGCGGTGCCAGCGCCGATTATTACAAGATCGAG
GCAAAGGCAGCCCTGCCAGAGTCGCTGGAGTCACGAGACGAAAGCCCGGGGGAGGAGACGGGTCAACGAGATTTG
GACGACGTACCGCTCGAGGGCGATGCGCTGGATAAGGGTAAGGGGCCAGCAGCAGCCGAGGAGGAGCTGCCTGAG
CTCGGACACGTACCATGTGCCCGTGTCGGCCACGCAACCGCCGTCATCGGCTCACGCATATTCTTGTTCGGCGGT
CGCGGCGGACGGGACATGGCGCCTCTGGACGAGGCAGGCCGCGTCTGGGTCTTCGACACGCGTTCTTGTACTTGG
TCGCACCTCGATCCCGTCTCGGCCGTCAGTGGCGACGCCGTCATTCCTCATCCGGAACCTCGCAGCTATCACTGC
GCAACCGCAATAGACCTTCCCCGCGACTTCGCCCGGCCGCGCCCTCGCAAGCCGCAGACTTGGCGGCAGTGGGCG
GTCGGAGACTCGGCCCGGACCGGCATCCCCCAGAACCCCATCGTCGGCAACGTCGCCGAAGACGCCGTCGACCAC
GAGTCGGAAGGTTACGGAACCTTTTTCATTCACGCAGGATGCCTTGCCAGCGGGGACCGCACCAGCGAGCTCTGG
GCCTTTGACATCAACTCTCGCACCTGGACAGAGCTCCCGGCCGCTCCCGGCCCGTGCCGTGAGGGGACTGCCATA
TGCGTCAGCAAGAGCCGACTCTTCCGCTTCGGCGGCTACGACGGCGCGCAAGAACTCGGCGGCCAGATCGACTTC
CTTCCTCTCGAGCTCGAGATGTTCGACGACCGCACGACCAAGGGAGAAGTCTCCGTCTACGCCCGCCCCGGCGGA
TGGAAGACGATCGTCGCCGACGACCAAAACGCCTCGTCCACCGACATCCCTGCCGAGGCCTCGCAGGACTGGCCC
GCCCCGCGCAGCTTCGGCTCCATGCAGGCGCTCACCCTCGGCGGCGGCCGCGAGTACCTCGTCCTCATCATGGGC
GAGCGCGTCCCAAGCCCCGAGGGCCACGACGGCGCCGGCATCTTCCTCAACGATGTCTGGGTCTTCCAGGTCCCG
CCGCTGGGCATGACAACGGCCAGCTTCAAGGACGCCATGCTGCAGGCCGTGGGCAGGAAGACGGGCGAAGGCAGG
TGGACCAAGGTATCGACGGCGCCCTACGACGACGCGACGGACGGTGAGCCGACCTCGAGGGGGTGGCTGGCGAGC
GCGCCCCTGGGCGACGTCGACGAGGGCGGGCTTGTGATTTGGGGCGGACTCGGAGAAGACAACAACCGCATCGGC
GACGGCTGGATCCTTAGGCTCAGGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail