Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9409
Gene name
LocationContig_682:1412..3128
Strand-
Gene length (bp)1716
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-24 16 398

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 18 447 8.0E-49
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 6 450 5.0E-30
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 239 409 4.0E-15
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 50 360 1.0E-12
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 2 411 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 18 447 8.0E-49
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 6 450 5.0E-30
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 239 409 4.0E-15
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 50 360 1.0E-12
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 2 411 7.0E-09
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 10 446 5.0E-08
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 19 453 4.0E-07
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 40 439 5.0E-07
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 19 453 1.0E-06
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 40 446 5.0E-06
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 264 414 6.0E-06
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 252 418 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 60 77 17
2 119 141 22
3 151 168 17
4 234 256 22
5 276 298 22
6 318 340 22
7 350 372 22
8 379 398 19
9 413 435 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9409
MTLVIFTGLSTQSIFTAQLKKEVHVSNADLINARAVEHAGEALGCVLFIPYATKYGRRSVYLVSISVYVAASWWF
ASMRAPWELYASNALKGFSAAVNETAVQMSIRDMFFLHRRGSANASYHFALSTAFSLIPMAAGAQATRFGWRSSS
TTQAVIVTVVLVLFLVSFEETKFVRAAAGDEAPDRDDACSIASREPINGRVLPRAPFPHYLRLQLLTPTGESLWR
IFYRPIYFWWLPHIVFTSLIFGTALMWVSVIGSLKGIIFSAPPYNFSPQELGYLHVTSFIGSLFGNLYGGFFVDW
AVVRMARRRGGLYEPEMRLYPLPVPAVAMSAGLAVFGITADRGLHWIYPSIGSALISLGFGGMASISFTLVVDAY
PNIISQAFVIIAFFRNVLGVVGPAVSNPWLDGMGLSGMFITAAVANLAVNGLAVGLLVWGKQIRTLTAERYYRLS
RED*
Coding >Hirsu2|9409
ATGACGCTCGTCATCTTCACGGGGCTGTCGACGCAGTCCATCTTCACGGCGCAGCTGAAGAAGGAGGTGCACGTG
TCGAACGCGGACCTGATCAACGCGCGGGCCGTCGAGCACGCGGGCGAGGCGCTGGGCTGCGTGCTCTTCATCCCG
TACGCGACCAAGTACGGCCGGCGGTCGGTGTATCTCGTCTCCATCTCCGTATACGTCGCGGCGTCGTGGTGGTTC
GCCAGCATGCGCGCGCCGTGGGAGCTGTACGCGTCCAACGCGCTCAAGGGCTTCTCGGCCGCCGTCAACGAGACG
GCCGTGCAGATGAGTATCCGCGACATGTTCTTCCTCCACAGGCGAGGCTCGGCCAACGCCTCCTACCACTTCGCC
CTCTCGACCGCCTTCTCGCTCATCCCCATGGCCGCGGGCGCGCAGGCGACGCGGTTCGGGTGGCGCTCGTCATCG
ACGACGCAGGCCGTCATCGTCACTGTTGTCCTCGTCCTCTTCCTCGTCTCCTTCGAGGAGACCAAGTTCGTGCGC
GCGGCGGCGGGCGACGAGGCGCCGGACCGGGACGACGCGTGCAGCATCGCCAGCCGCGAGCCCATCAACGGCCGC
GTCCTGCCGCGCGCGCCCTTCCCGCACTACCTCCGGCTGCAGCTGCTGACGCCGACGGGCGAGTCGCTGTGGCGC
ATCTTCTACCGCCCCATCTACTTCTGGTGGCTGCCGCACATCGTCTTCACCTCTTTGATTTTCGGCACCGCCCTG
ATGTGGGTCTCCGTCATCGGCTCGCTCAAGGGCATCATCTTCTCCGCGCCGCCGTACAACTTCAGCCCGCAGGAG
CTGGGATATCTGCACGTCACCTCCTTCATCGGCTCGCTCTTCGGCAATCTCTACGGCGGCTTCTTCGTCGACTGG
GCCGTCGTCCGCATGGCCCGGCGCCGGGGCGGCCTGTACGAGCCCGAGATGCGGCTGTACCCGCTGCCGGTGCCG
GCCGTCGCCATGTCGGCCGGCCTGGCCGTCTTTGGCATCACGGCCGATCGCGGCCTGCACTGGATATACCCCAGT
ATCGGGAGCGCCCTCATATCGCTCGGCTTCGGCGGCATGGCCAGCATCTCCTTCACGCTCGTCGTCGACGCCTAT
CCCAACATCATCTCGCAGGCCTTCGTCATCATCGCCTTCTTCCGCAACGTCCTCGGCGTCGTCGGCCCGGCCGTC
AGCAACCCGTGGCTCGACGGCATGGGCCTCAGCGGCATGTTCATCACCGCCGCCGTCGCCAACCTGGCCGTCAAC
GGACTGGCCGTCGGACTCTTGGTATGGGGGAAGCAGATCCGGACGCTCACCGCGGAGCGATACTATCGCCTGTCC
CGTGAAGACTAG
Transcript >Hirsu2|9409
ATGACGCTCGTCATCTTCACGGGGCTGTCGACGCAGTCCATCTTCACGGCGCAGCTGAAGAAGGAGGTGCACGTG
TCGAACGCGGACCTGATCAACGCGCGGGCCGTCGAGCACGCGGGCGAGGCGCTGGGCTGCGTGCTCTTCATCCCG
TACGCGACCAAGTACGGCCGGCGGTCGGTGTATCTCGTCTCCATCTCCGTATACGTCGCGGCGTCGTGGTGGTTC
GCCAGCATGCGCGCGCCGTGGGAGCTGTACGCGTCCAACGCGCTCAAGGGCTTCTCGGCCGCCGTCAACGAGACG
GCCGTGCAGATGAGTATCCGCGACATGTTCTTCCTCCACAGGCGAGGCTCGGCCAACGCCTCCTACCACTTCGCC
CTCTCGACCGCCTTCTCGCTCATCCCCATGGCCGCGGGCGCGCAGGCGACGCGGTTCGGGTGGCGCTCGTCATCG
ACGACGCAGGCCGTCATCGTCACTGTTGTCCTCGTCCTCTTCCTCGTCTCCTTCGAGGAGACCAAGTTCGTGCGC
GCGGCGGCGGGCGACGAGGCGCCGGACCGGGACGACGCGTGCAGCATCGCCAGCCGCGAGCCCATCAACGGCCGC
GTCCTGCCGCGCGCGCCCTTCCCGCACTACCTCCGGCTGCAGCTGCTGACGCCGACGGGCGAGTCGCTGTGGCGC
ATCTTCTACCGCCCCATCTACTTCTGGTGGCTGCCGCACATCGTCTTCACCTCTTTGATTTTCGGCACCGCCCTG
ATGTGGGTCTCCGTCATCGGCTCGCTCAAGGGCATCATCTTCTCCGCGCCGCCGTACAACTTCAGCCCGCAGGAG
CTGGGATATCTGCACGTCACCTCCTTCATCGGCTCGCTCTTCGGCAATCTCTACGGCGGCTTCTTCGTCGACTGG
GCCGTCGTCCGCATGGCCCGGCGCCGGGGCGGCCTGTACGAGCCCGAGATGCGGCTGTACCCGCTGCCGGTGCCG
GCCGTCGCCATGTCGGCCGGCCTGGCCGTCTTTGGCATCACGGCCGATCGCGGCCTGCACTGGATATACCCCAGT
ATCGGGAGCGCCCTCATATCGCTCGGCTTCGGCGGCATGGCCAGCATCTCCTTCACGCTCGTCGTCGACGCCTAT
CCCAACATCATCTCGCAGGCCTTCGTCATCATCGCCTTCTTCCGCAACGTCCTCGGCGTCGTCGGCCCGGCCGTC
AGCAACCCGTGGCTCGACGGCATGGGCCTCAGCGGCATGTTCATCACCGCCGCCGTCGCCAACCTGGCCGTCAAC
GGACTGGCCGTCGGACTCTTGGTATGGGGGAAGCAGATCCGGACGCTCACCGCGGAGCGATACTATCGCCTGTCC
CGTGAAGACTAG
Gene >Hirsu2|9409
ATGACGCTCGTCATCTTCACGGGGTGAGGCGCGAAAACCCGTCCGTTTGCCGGGCACGGCTCTGACGCTCTTGCG
GCCCAGGCTGTCGACGCAGTCCATCTTCACGGCGCAGCTGAAGAAGGAGGTGCACGTGTCGAACGCGGACCTGAT
CAACGCGCGGGCCGTCGAGCACGCGGGCGAGGCGCTGGGCTGCGTGCTCTTCATCCCGTACGCGACCAAGTACGG
CCGGCGGTCGGTGTATCTCGTCTCCATCTCCGTATACGTCGCGGCGTCGTGGTGGTTCGCCAGCATGCGCGCGCC
GTGGGAGCTGTACGCGTCCAACGCGCTCAAGGGCTTCTCGGCCGCCGTCAACGAGACGGCCGTGCAGATGAGTGT
GAGTCTGGGACCCGAGAAAGAGAGAGAGAGAAACGGCGGCTGACACGAGGAGAGGCGTCGCCGTTGCCCAGATCC
GCGACATGTTCTTCCTCCACAGGCGAGGCTCGGCCAACGCCTCCTACCACTTCGCCCTCTCGACCGCCTTCTCGC
TCATCCCCATGGCCGCGGGCGCGCAGGCGACGCGGTTCGGGTGGCGCTCGTCATCGACGACGCAGGCCGTCATCG
TCACTGTTGTCCTCGTCCTCTTCCTCGTCTCCTTCGAGGAGACCAAGTTCGTGCGCGCGGCGGCGGGCGACGAGG
CGCCGGACCGGGACGACGCGTGCAGCATCGCCAGCCGCGAGCCCATCAACGGCCGCGTCCTGCCGCGCGCGCCCT
TCCCGCACTACCTCCGGCTGCAGCTGCTGACGCCGACGGGCGAGTCGCTGTGGCGCATCTTCTACCGCCCCATCT
ACTTCTGGTGGCTGCCGCACATCGTCTTCACCTCTTTGATTTTCGGCACCGCCCTGATGTGGTGAGTCCGGCCCC
GGCCGCGGACCCGGGAATGCCTGCCCGTGGCCGGCAAGCTCGTGCTGGTGGTTGAGGTCGCTGACGGTGGTAGGG
TCTCCGTCATCGGCTCGCTCAAGGGCATCATCTTCTCCGCGCCGCCGTACAACTTCAGCCCGCAGGAGCTGGGAT
ATCTGCACGTCACCTCCTTCATCGGCTCGCTCTTCGGCAATCTCTACGGCGGCTTCTTCGTCGACTGGGCCGTCG
TCCGCATGGCCCGGCGCCGGGGCGGCCTGTACGAGCCCGAGATGCGGCTGTACCCGCTGCCGGTGCCGGCCGTCG
CCATGTCGGCCGGCCTGGCCGTCTTTGGCATCACGGCCGATCGCGTAATGCTCCCTCGCCCCTCGGGACCATGAT
GCTCGGAAGAGGGAGAGAGACTGACGCGGCGAGCAACAGGGCCTGCACTGGATATACCCCAGTATCGGGAGCGCC
CTCATATCGCTCGGCTTCGGCGGCATGGCCAGCATCTCCTTCACGCTCGTCGTCGACGCCTATCCCAACGTATGT
TCCTCTTCCCGGCATCTGCCCGGCTCCGTGTTGCTGACGTGCGCGCCCGCGCCAAAAAAGATCATCTCGCAGGCC
TTCGTCATCATCGCCTTCTTCCGCAACGTCCTCGGCGTCGTCGGCCCGGCCGTCAGCAACCCGTGGCTCGACGGC
ATGGGCCTCAGCGGCATGTTCATCACCGCCGCCGTCGCCAACCTGGCCGTCAACGGACTGGCCGTCGGACTCTTG
GTATGGGGGAAGCAGATCCGGACGCTCACCGCGGAGCGATACTATCGCCTGTCCCGTGAAGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail