Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9407
Gene name
LocationContig_681:5469..13945
Strand+
Gene length (bp)8476
Transcript length (bp)8427
Coding sequence length (bp)8427
Protein length (aa) 2809

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10344 Fmp27 Mitochondrial protein from FMP27 2.1E-208 17 886
PF10359 Fmp27_WPPW RNA pol II promoter Fmp27 protein domain 1.8E-177 1666 2195
PF10351 Apt1 Golgi-body localisation protein domain 1.8E-174 2209 2808
PF10293 DUF2405 Domain of unknown function (DUF2405) 5.3E-56 903 1060
PF10347 Fmp27_GFWDK RNA pol II promoter Fmp27 protein domain 2.7E-55 1251 1410
PF10305 Fmp27_SW RNA pol II promoter Fmp27 protein domain 1.2E-31 1133 1233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 903 2541 0.0E+00
sp|Q06179|FMP27_YEAST Protein FMP27, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP27 PE=1 SV=1 906 2532 2.0E-151
sp|Q06116|YP117_YEAST Uncharacterized protein YPR117W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR117W PE=1 SV=1 860 2537 2.0E-147
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 5 691 1.0E-29
sp|Q14667|K0100_HUMAN Protein KIAA0100 OS=Homo sapiens GN=KIAA0100 PE=1 SV=3 2280 2535 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 903 2541 0.0E+00
sp|Q06179|FMP27_YEAST Protein FMP27, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP27 PE=1 SV=1 906 2532 2.0E-151
sp|Q06116|YP117_YEAST Uncharacterized protein YPR117W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR117W PE=1 SV=1 860 2537 2.0E-147
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 5 691 1.0E-29
sp|Q14667|K0100_HUMAN Protein KIAA0100 OS=Homo sapiens GN=KIAA0100 PE=1 SV=3 2280 2535 3.0E-10
sp|Q5SYL3|K0100_MOUSE Protein KIAA0100 OS=Mus musculus GN=Kiaa0100 PE=1 SV=1 2280 2535 2.0E-09
sp|Q5SYL3|K0100_MOUSE Protein KIAA0100 OS=Mus musculus GN=Kiaa0100 PE=1 SV=1 1316 1452 8.0E-07
sp|Q14667|K0100_HUMAN Protein KIAA0100 OS=Homo sapiens GN=KIAA0100 PE=1 SV=3 1316 1409 9.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9407
MALLNPTFLLGLVVLTYLSSFVVFAVIRILTGVSIQRIGYLSLRRIAYTPRDGVRIELRSLGLNIHRPTFAQPTW
ISLVLSELVVTVDMSELQARKQAEAGLGQSSESESVPLSKTPPSCPDAQAASGGEAWRQVAKIKDRLKRLHRNIK
WLRMIDVVATNSTVNVVGVGDVQVGSFTVAVDTRRKIVDHARLFHKLHPRKRENRQAEWIFTVRSLLFTADGKDS
LEVLDHALLNVHGFLYESRDGLRDATVALKLGRVHVPYDDIQQCAAKLKQLRRGPKTLAAEAPRRDLLMGPVTLE
GDGEPAGRNDDLMQTISDSKELFSSILRNIKAVQFAVSFAGLTKRVTSVKPASSPILLNASMKEVGIDVHRLNPK
SPAHRMYFPSTDIAHQALAAALSISVGLDDGHGKPARLLYIPMATTTARTTLPSKTVQLAHDGSLEKNANILFAN
SVVTSPSVDLDPGHLPLLIAMMQPKPKPPKAHHQKRHHLISRLLPKANVKFSMHEPVVRIKLQPLQDTEDPDDFD
LIISSISSVSLDVESSHSSVEDMHYFLDGAMRLQSHRLYYQTCSGEILNLITTESLDLKAHLGASPDVCLDVTGH
IQSASVSMVRQEITDGLRQIVRQLHIDVEPEKRASSKTSKHQNFLRSMPEWLVRYHFEASDFTVEVAGVDEDISD
DTRGICLHLDSFSAEYRAHRLDGPQRRPPRRRTHSRSINQSDSDLTASPSSPRLRRKPQNVGDGRRLALHARGLE
VQIVEAADRLEVEPFVSIPRLELAFSASSDSHGPMFHIQSLVRTIMLQYSLYRHYSVGVAVMTLRKAFLRTGRDT
PRPRQQGTYLSPDRIPTSPGEPEADGVSTITHELLTVDIKASMVQLKAEMPHEPLLMFHAFGLEGGRHRWSTPFA
SFKLARLYVEPPRMRHVWAKLVSIKHGRVDLRESRHKTSLGGFAEEKMIDVATEAIRFAIPHEVIFSRITDNIIN
VFKAVLQLHHRFKTGTNEYILDKHPEGPKLVPKISIRSRNFLFELEDGAFEWKLGIIYRTGRVEQTQRLAREEAF
RVKSNRVREEASRRGSKVRSRSALARGRTENSSSSAWFRSRSLDSYQPDGQGGLGRWPMPRYDPDGESQGINGHA
KVSEVEAQAHLDLLNSQSWKKRIDRAYKESQSRTRDMRGAFWGNSSIPDDVEVTENILEVPQRPALMSLLVSDLH
VTLDKPTFAMRDLPEFIHKYGKGMPRDMLYTLLIPMHVAIGMGEARMSLRDYPLPLLHIPALKAGQSSRVPAVTL
KTNFVIAEEFRGPESTRRIMVNVIPPRNRDPASSNEGCFAIEVRRTVGAVKSYSDVYMDINSALPTRVTWGPCYQ
PAIQDMMMVIESFTKPVADPSEQVGFWDKIRLSFHSRIHVAWKGGGDMHLSLKGSRDPYYVLRDGAGFLMCWRSD
VRWNINTEPDPKRFMTVDSGEYILAIPDFSHLVREATARREADDTPATDGPSTDGPSTDGSLKGGAQFKKVVMKL
SGNVRWMAGLVLERAIVDGKRSFEFKPHYDVILKNPLYAKSEPGLPYDAFRGFRSRHIHMSIAVRSPADRAWTSH
DPEPSGSYNSVHLTPRFFTHFFQWWGLFSGPMSLPIRSGNLFPGREKNSKKFGRHLATVKYNLLLAPLFLSHIYK
HKDAEDYSENSVSATGLKIRFDSFMLDLHQRREEFNTLVKGKNTHNRTSGIKIHAAQLDLASADIRAVSASLMGT
TTEAIKKGSIAALITEQDDKPDLSKFTIPDHDLSWIDMDDFVELDWILPTEPHPETKIMPLAYAPRLTYFRQTDI
GGTIGGDPTRTSPFGNEPTHFCLMTHDDDPKLVQARLIQERLDQLEEQMLTHSRAVGEAELKVIQTNSQDHDMVE
VLETLRRHTGVLKEKKAFLENMLEQMNAPSPAGGSSEDGGRKRSGASSRASDGVLNIPSTAEFESDFENRFVIHN
MQLKWNNLLRNIVLRYIHQNGQRRGFIYYLSRPAIKFIQDLVEEQGKAKSHHKPPKAASTTGASTPSQGGGGGAA
ERDAAHELEDRIKGILNHHHNNHNNNNNNYNDGRPYSTSTSFEANGDGTCASIEDLESGISKEYSPQRGYHVRLI
GPQIQLQSDKNKKHVVLVTAKGMELKVLEVMDKQRISDTVSGLVQRRFLVSMDSTQFFVTHQKWFSTNLVSMYAG
SRYGTPRGSSWPPWVPMEIMFSFTADHPVGFRRVVQKTSARLRYDKYNNLRLKYNDEVNTDEGPAAAATAATAAG
GEPAADGGAAAECRSDNVWVEFPQARALCNSSQYYAMYVIVLDLLMYSEPLEKTRSERLEKIMLASDFSDLSGAP
QMVLKLQQRIKQIEEIKSHFQVYSSYLDLRGWEDRLALERDLAACEDELFFMMKAITTAQRKYEVDSESDANALL
RWNISAHEIVWHLMQDSNEALVELQLKDVEYDRTDNSDGSHANLIRVGKVLGLNLLQDATYPEIIGPYHGEDKTW
PAQGGLLGDGGSDMIRVYWHMLEAIAGIPVMDRFEVNLFPMRIQLEREAGKRIFSYIFPGMDGEKGPSGSGSGSG
RNNSPYMIKHDMAAGQDEDSESLASSSSRLGTPSMDNGAGGGGHHHDSAGFTTKAGSLEHRLRPTLASHGLQHDR
SPKRPHGSGGHHLPHLHHHGSVSGGGSGTGGEGHSFKLFRSAGTGKTMLSKKSSHDSLRAAGPGTRAGSVCRSST
GLSSKDGRGGGGEHHLHLHHHGSNEGKKGPARFGLRGKGQGGGGGDDKQQQQQSDDLSKMMTRASNYMTFAHIKM
PSVVLCLSYKGKDQRNFEDVHDFVFRLPTIERR*
Coding >Hirsu2|9407
ATGGCCCTCCTGAACCCGACTTTCCTGCTCGGCCTCGTCGTCCTCACCTATCTGTCCTCCTTCGTCGTCTTCGCC
GTCATTCGAATCTTGACGGGCGTGTCGATCCAGCGCATCGGCTACCTCTCCCTGCGACGCATCGCCTACACGCCC
CGCGATGGCGTCCGCATCGAGCTTCGCAGCCTCGGCCTCAACATCCACCGGCCCACCTTTGCGCAGCCGACATGG
ATAAGCCTCGTCCTGAGCGAGTTGGTCGTCACCGTCGACATGAGCGAGCTCCAGGCGCGGAAACAGGCAGAGGCC
GGCCTCGGCCAGTCCTCCGAGTCCGAGTCCGTGCCGCTGTCCAAGACACCACCCTCGTGCCCCGACGCGCAGGCC
GCGTCCGGGGGTGAGGCCTGGAGGCAGGTGGCCAAGATCAAGGACAGGCTCAAGAGGCTGCACCGCAACATCAAG
TGGCTCCGCATGATCGACGTCGTCGCCACCAATTCCACCGTCAACGTCGTCGGCGTCGGCGACGTCCAGGTCGGC
AGCTTCACCGTCGCCGTCGACACGAGGCGCAAGATCGTCGACCACGCCCGTCTCTTCCACAAGCTGCACCCGCGC
AAGCGCGAGAACCGCCAGGCTGAGTGGATCTTCACCGTCCGGAGCCTCCTCTTCACCGCCGACGGGAAAGACTCG
CTCGAGGTGCTGGATCACGCGCTGCTCAACGTCCACGGCTTCCTCTACGAATCGCGCGACGGCTTGCGCGACGCC
ACCGTCGCCCTCAAGCTGGGCAGGGTCCACGTGCCGTACGACGACATCCAACAGTGCGCCGCCAAGCTCAAGCAG
CTGCGCCGCGGCCCCAAGACCCTCGCCGCCGAGGCGCCGAGGCGCGACCTCCTCATGGGCCCCGTCACGCTCGAG
GGCGACGGGGAGCCGGCCGGCAGGAACGACGACCTGATGCAGACAATCTCCGACTCCAAGGAGCTCTTCAGCTCC
ATCCTGCGCAACATCAAGGCCGTCCAGTTCGCCGTCAGCTTCGCCGGCCTGACCAAGAGGGTCACCTCGGTCAAG
CCGGCCTCGAGCCCCATCCTGCTCAACGCCTCGATGAAGGAGGTCGGCATCGACGTCCATCGCCTCAACCCCAAG
TCGCCCGCGCACCGCATGTACTTCCCGTCCACGGACATCGCCCACCAGGCCCTGGCCGCCGCCCTGTCCATCTCG
GTCGGCCTCGACGACGGCCACGGCAAGCCGGCCCGGCTGCTCTACATACCCATGGCCACCACCACCGCCCGCACG
ACGCTGCCCTCCAAGACGGTCCAGCTGGCGCACGACGGGAGCCTCGAGAAGAACGCCAACATCCTCTTCGCCAAC
TCCGTCGTCACCTCGCCCTCGGTCGACCTCGACCCCGGCCATCTGCCCCTCCTCATCGCCATGATGCAGCCGAAG
CCGAAGCCGCCCAAGGCCCATCACCAGAAGCGCCACCACCTCATCTCGCGCCTCCTCCCCAAGGCCAACGTCAAG
TTCTCCATGCACGAGCCCGTCGTCCGCATCAAGCTCCAGCCGCTGCAGGACACGGAAGACCCGGACGACTTCGAC
CTCATCATCTCCTCCATCTCGTCCGTCTCCCTCGACGTCGAGTCGTCCCACTCCTCCGTCGAGGACATGCACTAC
TTCCTCGACGGGGCCATGCGGCTGCAGTCCCACCGCCTCTACTACCAGACCTGCTCCGGCGAGATCCTGAACCTC
ATCACGACCGAGTCCCTCGACCTCAAGGCCCACCTGGGGGCCTCGCCCGACGTCTGCCTCGACGTCACCGGCCAC
ATACAGTCCGCCTCCGTCAGCATGGTCAGGCAGGAGATCACCGACGGCCTGCGCCAGATCGTCAGGCAGCTGCAC
ATCGACGTCGAGCCGGAAAAGCGGGCCAGCTCCAAGACGAGCAAGCACCAGAACTTCCTCCGCTCCATGCCCGAA
TGGCTCGTGCGCTACCACTTCGAGGCGTCCGACTTCACCGTCGAGGTCGCCGGCGTCGACGAGGACATCTCGGAC
GACACCAGGGGCATCTGCCTGCACCTCGACTCCTTCTCCGCCGAGTACCGCGCACACAGGCTGGACGGGCCCCAG
CGACGCCCACCCAGGAGGCGGACGCACAGCAGGTCCATCAACCAGTCCGACTCCGATCTTACCGCCTCGCCCTCG
TCGCCGAGGCTCAGGAGGAAGCCGCAGAACGTCGGCGACGGCCGCCGCCTCGCCCTGCATGCCCGCGGGCTCGAG
GTCCAGATCGTCGAGGCCGCGGATCGGCTCGAGGTCGAGCCCTTCGTCAGCATCCCTCGCCTCGAGCTCGCCTTC
TCGGCGTCCAGCGACAGCCACGGCCCCATGTTCCATATCCAGTCCCTGGTCCGCACCATCATGCTGCAGTATTCT
CTCTACCGACACTACTCCGTCGGCGTCGCCGTCATGACCCTGCGCAAGGCCTTCTTGAGGACCGGCCGGGACACC
CCGAGACCTCGCCAGCAGGGCACCTACCTCAGCCCCGACCGGATCCCTACGTCGCCCGGCGAACCCGAGGCCGAC
GGCGTCTCGACCATCACTCACGAGCTCCTGACCGTGGACATCAAGGCCTCCATGGTCCAGCTGAAGGCCGAGATG
CCCCATGAGCCGTTGCTGATGTTCCACGCCTTCGGCCTGGAAGGCGGCCGGCACAGGTGGTCGACCCCCTTCGCG
TCCTTCAAGCTCGCGCGCCTCTACGTGGAGCCTCCGCGCATGCGCCACGTTTGGGCCAAGCTCGTCAGCATCAAG
CACGGCCGAGTCGACCTGCGCGAGTCGAGGCACAAGACGTCACTGGGCGGCTTCGCCGAGGAGAAGATGATCGAC
GTCGCCACCGAAGCCATCCGGTTCGCGATCCCCCACGAAGTCATCTTCAGCCGAATCACGGACAACATCATCAAC
GTCTTCAAGGCCGTGCTGCAGTTGCATCACCGCTTCAAGACGGGGACGAACGAATACATCCTGGACAAGCACCCC
GAGGGCCCCAAACTGGTCCCCAAGATCTCCATCAGGTCGCGCAACTTCCTGTTCGAGCTCGAGGACGGCGCTTTC
GAGTGGAAACTGGGCATCATCTACCGCACCGGCCGCGTGGAACAGACGCAGAGGCTGGCGCGCGAGGAGGCTTTC
CGCGTCAAGTCGAATAGGGTGCGCGAGGAAGCGTCGAGACGGGGAAGCAAGGTCCGGTCGAGGTCGGCGCTGGCA
CGCGGCCGCACGGAAAACTCGTCGTCGTCTGCGTGGTTCAGGAGCCGAAGCCTCGACAGCTACCAGCCTGACGGC
CAGGGCGGCCTCGGCCGGTGGCCCATGCCGAGATACGACCCGGACGGCGAGAGCCAGGGAATCAACGGGCACGCC
AAGGTGTCCGAGGTCGAGGCACAAGCCCACCTGGACCTGCTCAACTCGCAGTCTTGGAAGAAGCGCATCGACCGC
GCCTACAAGGAGTCGCAGTCACGGACGAGGGACATGCGAGGAGCGTTCTGGGGCAACAGTTCGATCCCCGACGAC
GTCGAGGTGACCGAGAACATCCTCGAGGTGCCCCAGCGGCCCGCCCTCATGTCTCTCCTGGTGTCCGACCTCCAC
GTCACCCTGGACAAGCCGACCTTTGCGATGCGGGACCTGCCCGAGTTCATCCACAAGTACGGCAAGGGGATGCCG
CGCGACATGCTGTACACCCTCCTGATCCCCATGCACGTCGCCATCGGCATGGGCGAGGCGCGCATGTCGCTGCGC
GACTACCCGCTGCCCCTGCTGCACATCCCGGCCCTCAAGGCCGGGCAGTCGTCCAGGGTGCCGGCCGTGACGCTC
AAGACCAACTTCGTCATAGCCGAAGAGTTCCGGGGCCCCGAGTCGACGCGACGGATCATGGTCAACGTCATCCCG
CCGAGGAACAGGGACCCGGCCTCGTCCAACGAGGGCTGCTTCGCCATCGAGGTCCGGCGCACGGTCGGCGCCGTC
AAGTCGTACTCGGACGTCTACATGGACATCAACTCGGCCCTCCCCACCCGGGTCACATGGGGGCCCTGCTACCAG
CCGGCCATCCAGGACATGATGATGGTGATCGAGTCCTTCACGAAGCCCGTCGCGGACCCCTCGGAGCAGGTCGGC
TTCTGGGACAAGATCAGGCTCAGCTTCCACTCCCGCATCCACGTCGCCTGGAAGGGAGGCGGCGACATGCACCTC
TCCCTCAAGGGCAGCCGTGACCCGTACTACGTGCTGCGCGACGGCGCCGGCTTCCTGATGTGCTGGCGGAGCGAC
GTGCGGTGGAACATCAACACCGAGCCCGACCCGAAGCGGTTCATGACGGTCGACAGCGGCGAGTACATCCTGGCC
ATTCCCGACTTCAGCCATCTGGTCCGGGAGGCGACGGCCCGCCGCGAGGCGGACGACACCCCGGCCACGGACGGC
CCCTCCACGGACGGCCCCTCCACGGACGGGAGCCTCAAGGGAGGAGCGCAGTTCAAGAAGGTCGTGATGAAGCTC
TCGGGCAACGTCCGGTGGATGGCCGGGCTGGTGCTCGAGCGCGCCATCGTGGACGGGAAGCGCAGCTTCGAGTTC
AAGCCTCACTACGACGTCATCCTGAAGAACCCCCTCTACGCCAAGTCGGAGCCGGGCCTGCCCTACGACGCCTTC
CGGGGGTTCCGGAGCCGGCACATCCACATGTCCATCGCCGTGCGGTCGCCGGCGGACCGCGCGTGGACGTCCCAC
GACCCGGAGCCGTCCGGGAGCTACAACTCGGTGCACCTGACGCCCCGGTTCTTCACGCACTTCTTCCAGTGGTGG
GGGCTGTTCAGCGGGCCCATGTCGCTGCCGATCCGGTCGGGCAACCTGTTCCCGGGGCGCGAGAAGAACAGCAAG
AAGTTCGGCCGACACCTGGCGACGGTCAAGTACAACCTGCTGCTGGCGCCGCTCTTCCTCAGCCACATCTACAAG
CACAAGGACGCCGAGGACTACTCGGAGAACTCCGTGTCGGCGACGGGCCTCAAGATCCGCTTCGACAGCTTCATG
CTCGACCTGCACCAGCGGAGAGAGGAGTTCAACACGCTGGTCAAGGGCAAGAACACGCACAACAGGACGTCCGGC
ATCAAGATCCACGCGGCGCAGCTCGACCTGGCCAGCGCCGACATCCGGGCCGTCTCCGCCAGCCTGATGGGCACG
ACGACCGAGGCCATCAAGAAGGGCTCCATCGCGGCGCTCATCACGGAGCAGGACGACAAGCCCGACCTGTCCAAG
TTCACGATCCCGGACCACGACCTGAGCTGGATCGACATGGACGACTTCGTCGAGCTGGACTGGATCCTGCCGACG
GAGCCGCACCCGGAGACCAAGATCATGCCGCTGGCCTACGCGCCGCGGCTGACGTACTTCCGCCAGACGGACATC
GGCGGCACCATCGGCGGCGACCCGACGCGGACGAGCCCCTTCGGCAACGAGCCGACGCACTTCTGCCTGATGACG
CACGACGACGACCCGAAGCTGGTGCAGGCCCGGCTGATCCAGGAGCGGCTCGACCAGCTCGAGGAGCAGATGCTG
ACGCACTCGAGAGCCGTGGGCGAGGCCGAGCTCAAGGTGATCCAGACCAACTCGCAGGACCACGACATGGTCGAG
GTGCTCGAGACGCTGAGGAGGCACACCGGCGTGCTCAAGGAGAAGAAGGCCTTCCTGGAGAACATGCTGGAGCAG
ATGAACGCGCCGTCGCCCGCGGGCGGCAGCAGCGAGGACGGCGGGAGGAAGCGGTCCGGGGCGTCGTCGCGGGCC
AGCGACGGCGTCCTCAACATCCCGTCGACGGCCGAGTTCGAGAGCGACTTTGAGAACCGGTTCGTGATCCACAAC
ATGCAGCTCAAGTGGAACAACCTGCTGCGCAACATCGTGCTGCGCTACATCCACCAGAACGGCCAGCGGCGCGGC
TTCATCTACTACCTCTCGCGGCCGGCCATCAAGTTCATCCAGGACCTGGTGGAGGAGCAGGGCAAGGCCAAGTCG
CACCACAAGCCGCCCAAGGCGGCCTCGACAACGGGGGCCTCGACGCCCAGCCAGGGCGGCGGCGGCGGCGCGGCG
GAGAGGGACGCGGCGCACGAGCTCGAGGACCGCATCAAGGGCATCCTCAACCACCACCACAACAACCACAATAAC
AATAACAACAACTACAACGACGGGCGGCCCTACTCGACAAGCACCAGCTTCGAGGCCAACGGGGACGGGACCTGC
GCCTCCATCGAAGACCTGGAGAGCGGCATCTCGAAGGAGTACAGCCCCCAGCGCGGCTACCACGTGCGGCTGATC
GGGCCGCAGATCCAGCTGCAGAGCGACAAGAACAAGAAGCACGTCGTCCTGGTGACGGCCAAGGGCATGGAGCTC
AAGGTGCTCGAGGTCATGGACAAGCAGCGGATCTCGGACACGGTCAGCGGCCTGGTGCAGCGCCGGTTCCTCGTC
AGCATGGACAGCACGCAGTTCTTCGTCACGCACCAGAAGTGGTTCTCGACCAACCTGGTGTCCATGTACGCCGGC
AGCCGGTACGGCACGCCCAGGGGCTCGTCGTGGCCGCCGTGGGTGCCGATGGAGATCATGTTCAGCTTCACGGCC
GACCACCCGGTCGGCTTCCGGCGCGTCGTCCAGAAGACGTCGGCCCGGCTCCGGTACGACAAGTACAACAACCTG
CGGCTCAAGTACAACGACGAGGTCAACACGGACGAGGGGCCGGCGGCGGCGGCGACGGCGGCGACGGCTGCGGGC
GGCGAGCCGGCGGCGGACGGCGGAGCGGCCGCCGAGTGCCGCTCCGACAACGTCTGGGTCGAGTTCCCGCAGGCC
AGGGCGCTCTGCAACTCGTCGCAGTACTACGCCATGTACGTCATCGTGCTGGACCTTCTCATGTACAGCGAGCCG
CTGGAGAAGACGCGCAGCGAGCGGCTGGAGAAGATCATGCTCGCGTCCGACTTCAGCGACCTCAGCGGCGCGCCG
CAGATGGTGCTGAAGCTGCAGCAGCGGATCAAGCAGATCGAGGAGATCAAGAGCCACTTCCAGGTCTACTCCAGC
TACCTCGACCTGCGGGGTTGGGAGGACCGGCTGGCGCTGGAGCGGGACCTGGCCGCGTGCGAGGACGAGCTCTTC
TTCATGATGAAGGCCATCACGACGGCGCAGAGGAAGTACGAGGTGGACAGCGAGAGCGACGCCAACGCGCTGCTG
CGGTGGAACATCTCGGCGCACGAGATTGTGTGGCACCTGATGCAGGACTCGAACGAGGCGCTGGTCGAGCTGCAG
CTCAAGGACGTCGAGTACGACCGGACGGACAACTCGGACGGCTCGCACGCGAACCTGATTCGCGTCGGCAAGGTG
CTGGGCCTCAACCTGCTGCAGGACGCGACGTACCCGGAGATCATCGGGCCCTACCACGGCGAGGACAAGACGTGG
CCGGCGCAGGGCGGGCTGCTCGGGGACGGCGGCAGCGACATGATCCGGGTCTACTGGCACATGCTCGAGGCGATC
GCTGGGATCCCCGTCATGGACCGGTTCGAGGTGAACCTGTTCCCGATGAGGATCCAGCTGGAGCGCGAGGCCGGC
AAGCGCATCTTCAGCTACATCTTCCCCGGTATGGACGGGGAGAAGGGGCCGTCGGGGTCGGGGTCGGGGTCGGGG
CGGAACAACTCGCCGTACATGATCAAGCACGACATGGCCGCCGGCCAGGACGAGGACAGCGAGTCGCTGGCGAGC
TCGAGCAGCCGTCTGGGCACGCCGTCGATGGACAACGGCGCCGGCGGCGGCGGCCACCACCACGACTCGGCGGGC
TTCACGACCAAGGCGGGATCGCTGGAGCATCGGCTGCGGCCGACGCTGGCGTCGCACGGCCTGCAACACGACCGG
AGCCCCAAGAGGCCGCACGGCTCGGGCGGCCACCACCTGCCGCACCTCCACCACCACGGCAGCGTCAGCGGCGGC
GGCAGCGGCACCGGCGGCGAGGGCCACTCGTTCAAGCTGTTCCGGTCGGCCGGGACGGGCAAGACGATGCTGTCC
AAGAAGTCGTCGCACGACTCGCTCCGAGCAGCGGGGCCGGGGACGCGGGCCGGGAGCGTGTGCCGGTCGTCGACG
GGCCTCTCGTCCAAGGACGGGCGCGGCGGCGGCGGCGAGCACCACCTCCACCTCCACCATCACGGGTCGAACGAG
GGCAAGAAGGGCCCGGCGCGGTTCGGGCTGCGCGGCAAGGGGCAGGGCGGCGGCGGCGGCGACGACAAGCAGCAG
CAGCAGCAGTCGGACGACCTGAGCAAGATGATGACGCGGGCGAGCAACTACATGACGTTTGCGCACATCAAGATG
CCGTCGGTGGTGCTGTGCCTCAGCTACAAGGGCAAGGACCAGCGCAACTTTGAGGACGTGCACGACTTCGTCTTC
CGGCTGCCGACGATCGAAAGGCGGTGA
Transcript >Hirsu2|9407
ATGGCCCTCCTGAACCCGACTTTCCTGCTCGGCCTCGTCGTCCTCACCTATCTGTCCTCCTTCGTCGTCTTCGCC
GTCATTCGAATCTTGACGGGCGTGTCGATCCAGCGCATCGGCTACCTCTCCCTGCGACGCATCGCCTACACGCCC
CGCGATGGCGTCCGCATCGAGCTTCGCAGCCTCGGCCTCAACATCCACCGGCCCACCTTTGCGCAGCCGACATGG
ATAAGCCTCGTCCTGAGCGAGTTGGTCGTCACCGTCGACATGAGCGAGCTCCAGGCGCGGAAACAGGCAGAGGCC
GGCCTCGGCCAGTCCTCCGAGTCCGAGTCCGTGCCGCTGTCCAAGACACCACCCTCGTGCCCCGACGCGCAGGCC
GCGTCCGGGGGTGAGGCCTGGAGGCAGGTGGCCAAGATCAAGGACAGGCTCAAGAGGCTGCACCGCAACATCAAG
TGGCTCCGCATGATCGACGTCGTCGCCACCAATTCCACCGTCAACGTCGTCGGCGTCGGCGACGTCCAGGTCGGC
AGCTTCACCGTCGCCGTCGACACGAGGCGCAAGATCGTCGACCACGCCCGTCTCTTCCACAAGCTGCACCCGCGC
AAGCGCGAGAACCGCCAGGCTGAGTGGATCTTCACCGTCCGGAGCCTCCTCTTCACCGCCGACGGGAAAGACTCG
CTCGAGGTGCTGGATCACGCGCTGCTCAACGTCCACGGCTTCCTCTACGAATCGCGCGACGGCTTGCGCGACGCC
ACCGTCGCCCTCAAGCTGGGCAGGGTCCACGTGCCGTACGACGACATCCAACAGTGCGCCGCCAAGCTCAAGCAG
CTGCGCCGCGGCCCCAAGACCCTCGCCGCCGAGGCGCCGAGGCGCGACCTCCTCATGGGCCCCGTCACGCTCGAG
GGCGACGGGGAGCCGGCCGGCAGGAACGACGACCTGATGCAGACAATCTCCGACTCCAAGGAGCTCTTCAGCTCC
ATCCTGCGCAACATCAAGGCCGTCCAGTTCGCCGTCAGCTTCGCCGGCCTGACCAAGAGGGTCACCTCGGTCAAG
CCGGCCTCGAGCCCCATCCTGCTCAACGCCTCGATGAAGGAGGTCGGCATCGACGTCCATCGCCTCAACCCCAAG
TCGCCCGCGCACCGCATGTACTTCCCGTCCACGGACATCGCCCACCAGGCCCTGGCCGCCGCCCTGTCCATCTCG
GTCGGCCTCGACGACGGCCACGGCAAGCCGGCCCGGCTGCTCTACATACCCATGGCCACCACCACCGCCCGCACG
ACGCTGCCCTCCAAGACGGTCCAGCTGGCGCACGACGGGAGCCTCGAGAAGAACGCCAACATCCTCTTCGCCAAC
TCCGTCGTCACCTCGCCCTCGGTCGACCTCGACCCCGGCCATCTGCCCCTCCTCATCGCCATGATGCAGCCGAAG
CCGAAGCCGCCCAAGGCCCATCACCAGAAGCGCCACCACCTCATCTCGCGCCTCCTCCCCAAGGCCAACGTCAAG
TTCTCCATGCACGAGCCCGTCGTCCGCATCAAGCTCCAGCCGCTGCAGGACACGGAAGACCCGGACGACTTCGAC
CTCATCATCTCCTCCATCTCGTCCGTCTCCCTCGACGTCGAGTCGTCCCACTCCTCCGTCGAGGACATGCACTAC
TTCCTCGACGGGGCCATGCGGCTGCAGTCCCACCGCCTCTACTACCAGACCTGCTCCGGCGAGATCCTGAACCTC
ATCACGACCGAGTCCCTCGACCTCAAGGCCCACCTGGGGGCCTCGCCCGACGTCTGCCTCGACGTCACCGGCCAC
ATACAGTCCGCCTCCGTCAGCATGGTCAGGCAGGAGATCACCGACGGCCTGCGCCAGATCGTCAGGCAGCTGCAC
ATCGACGTCGAGCCGGAAAAGCGGGCCAGCTCCAAGACGAGCAAGCACCAGAACTTCCTCCGCTCCATGCCCGAA
TGGCTCGTGCGCTACCACTTCGAGGCGTCCGACTTCACCGTCGAGGTCGCCGGCGTCGACGAGGACATCTCGGAC
GACACCAGGGGCATCTGCCTGCACCTCGACTCCTTCTCCGCCGAGTACCGCGCACACAGGCTGGACGGGCCCCAG
CGACGCCCACCCAGGAGGCGGACGCACAGCAGGTCCATCAACCAGTCCGACTCCGATCTTACCGCCTCGCCCTCG
TCGCCGAGGCTCAGGAGGAAGCCGCAGAACGTCGGCGACGGCCGCCGCCTCGCCCTGCATGCCCGCGGGCTCGAG
GTCCAGATCGTCGAGGCCGCGGATCGGCTCGAGGTCGAGCCCTTCGTCAGCATCCCTCGCCTCGAGCTCGCCTTC
TCGGCGTCCAGCGACAGCCACGGCCCCATGTTCCATATCCAGTCCCTGGTCCGCACCATCATGCTGCAGTATTCT
CTCTACCGACACTACTCCGTCGGCGTCGCCGTCATGACCCTGCGCAAGGCCTTCTTGAGGACCGGCCGGGACACC
CCGAGACCTCGCCAGCAGGGCACCTACCTCAGCCCCGACCGGATCCCTACGTCGCCCGGCGAACCCGAGGCCGAC
GGCGTCTCGACCATCACTCACGAGCTCCTGACCGTGGACATCAAGGCCTCCATGGTCCAGCTGAAGGCCGAGATG
CCCCATGAGCCGTTGCTGATGTTCCACGCCTTCGGCCTGGAAGGCGGCCGGCACAGGTGGTCGACCCCCTTCGCG
TCCTTCAAGCTCGCGCGCCTCTACGTGGAGCCTCCGCGCATGCGCCACGTTTGGGCCAAGCTCGTCAGCATCAAG
CACGGCCGAGTCGACCTGCGCGAGTCGAGGCACAAGACGTCACTGGGCGGCTTCGCCGAGGAGAAGATGATCGAC
GTCGCCACCGAAGCCATCCGGTTCGCGATCCCCCACGAAGTCATCTTCAGCCGAATCACGGACAACATCATCAAC
GTCTTCAAGGCCGTGCTGCAGTTGCATCACCGCTTCAAGACGGGGACGAACGAATACATCCTGGACAAGCACCCC
GAGGGCCCCAAACTGGTCCCCAAGATCTCCATCAGGTCGCGCAACTTCCTGTTCGAGCTCGAGGACGGCGCTTTC
GAGTGGAAACTGGGCATCATCTACCGCACCGGCCGCGTGGAACAGACGCAGAGGCTGGCGCGCGAGGAGGCTTTC
CGCGTCAAGTCGAATAGGGTGCGCGAGGAAGCGTCGAGACGGGGAAGCAAGGTCCGGTCGAGGTCGGCGCTGGCA
CGCGGCCGCACGGAAAACTCGTCGTCGTCTGCGTGGTTCAGGAGCCGAAGCCTCGACAGCTACCAGCCTGACGGC
CAGGGCGGCCTCGGCCGGTGGCCCATGCCGAGATACGACCCGGACGGCGAGAGCCAGGGAATCAACGGGCACGCC
AAGGTGTCCGAGGTCGAGGCACAAGCCCACCTGGACCTGCTCAACTCGCAGTCTTGGAAGAAGCGCATCGACCGC
GCCTACAAGGAGTCGCAGTCACGGACGAGGGACATGCGAGGAGCGTTCTGGGGCAACAGTTCGATCCCCGACGAC
GTCGAGGTGACCGAGAACATCCTCGAGGTGCCCCAGCGGCCCGCCCTCATGTCTCTCCTGGTGTCCGACCTCCAC
GTCACCCTGGACAAGCCGACCTTTGCGATGCGGGACCTGCCCGAGTTCATCCACAAGTACGGCAAGGGGATGCCG
CGCGACATGCTGTACACCCTCCTGATCCCCATGCACGTCGCCATCGGCATGGGCGAGGCGCGCATGTCGCTGCGC
GACTACCCGCTGCCCCTGCTGCACATCCCGGCCCTCAAGGCCGGGCAGTCGTCCAGGGTGCCGGCCGTGACGCTC
AAGACCAACTTCGTCATAGCCGAAGAGTTCCGGGGCCCCGAGTCGACGCGACGGATCATGGTCAACGTCATCCCG
CCGAGGAACAGGGACCCGGCCTCGTCCAACGAGGGCTGCTTCGCCATCGAGGTCCGGCGCACGGTCGGCGCCGTC
AAGTCGTACTCGGACGTCTACATGGACATCAACTCGGCCCTCCCCACCCGGGTCACATGGGGGCCCTGCTACCAG
CCGGCCATCCAGGACATGATGATGGTGATCGAGTCCTTCACGAAGCCCGTCGCGGACCCCTCGGAGCAGGTCGGC
TTCTGGGACAAGATCAGGCTCAGCTTCCACTCCCGCATCCACGTCGCCTGGAAGGGAGGCGGCGACATGCACCTC
TCCCTCAAGGGCAGCCGTGACCCGTACTACGTGCTGCGCGACGGCGCCGGCTTCCTGATGTGCTGGCGGAGCGAC
GTGCGGTGGAACATCAACACCGAGCCCGACCCGAAGCGGTTCATGACGGTCGACAGCGGCGAGTACATCCTGGCC
ATTCCCGACTTCAGCCATCTGGTCCGGGAGGCGACGGCCCGCCGCGAGGCGGACGACACCCCGGCCACGGACGGC
CCCTCCACGGACGGCCCCTCCACGGACGGGAGCCTCAAGGGAGGAGCGCAGTTCAAGAAGGTCGTGATGAAGCTC
TCGGGCAACGTCCGGTGGATGGCCGGGCTGGTGCTCGAGCGCGCCATCGTGGACGGGAAGCGCAGCTTCGAGTTC
AAGCCTCACTACGACGTCATCCTGAAGAACCCCCTCTACGCCAAGTCGGAGCCGGGCCTGCCCTACGACGCCTTC
CGGGGGTTCCGGAGCCGGCACATCCACATGTCCATCGCCGTGCGGTCGCCGGCGGACCGCGCGTGGACGTCCCAC
GACCCGGAGCCGTCCGGGAGCTACAACTCGGTGCACCTGACGCCCCGGTTCTTCACGCACTTCTTCCAGTGGTGG
GGGCTGTTCAGCGGGCCCATGTCGCTGCCGATCCGGTCGGGCAACCTGTTCCCGGGGCGCGAGAAGAACAGCAAG
AAGTTCGGCCGACACCTGGCGACGGTCAAGTACAACCTGCTGCTGGCGCCGCTCTTCCTCAGCCACATCTACAAG
CACAAGGACGCCGAGGACTACTCGGAGAACTCCGTGTCGGCGACGGGCCTCAAGATCCGCTTCGACAGCTTCATG
CTCGACCTGCACCAGCGGAGAGAGGAGTTCAACACGCTGGTCAAGGGCAAGAACACGCACAACAGGACGTCCGGC
ATCAAGATCCACGCGGCGCAGCTCGACCTGGCCAGCGCCGACATCCGGGCCGTCTCCGCCAGCCTGATGGGCACG
ACGACCGAGGCCATCAAGAAGGGCTCCATCGCGGCGCTCATCACGGAGCAGGACGACAAGCCCGACCTGTCCAAG
TTCACGATCCCGGACCACGACCTGAGCTGGATCGACATGGACGACTTCGTCGAGCTGGACTGGATCCTGCCGACG
GAGCCGCACCCGGAGACCAAGATCATGCCGCTGGCCTACGCGCCGCGGCTGACGTACTTCCGCCAGACGGACATC
GGCGGCACCATCGGCGGCGACCCGACGCGGACGAGCCCCTTCGGCAACGAGCCGACGCACTTCTGCCTGATGACG
CACGACGACGACCCGAAGCTGGTGCAGGCCCGGCTGATCCAGGAGCGGCTCGACCAGCTCGAGGAGCAGATGCTG
ACGCACTCGAGAGCCGTGGGCGAGGCCGAGCTCAAGGTGATCCAGACCAACTCGCAGGACCACGACATGGTCGAG
GTGCTCGAGACGCTGAGGAGGCACACCGGCGTGCTCAAGGAGAAGAAGGCCTTCCTGGAGAACATGCTGGAGCAG
ATGAACGCGCCGTCGCCCGCGGGCGGCAGCAGCGAGGACGGCGGGAGGAAGCGGTCCGGGGCGTCGTCGCGGGCC
AGCGACGGCGTCCTCAACATCCCGTCGACGGCCGAGTTCGAGAGCGACTTTGAGAACCGGTTCGTGATCCACAAC
ATGCAGCTCAAGTGGAACAACCTGCTGCGCAACATCGTGCTGCGCTACATCCACCAGAACGGCCAGCGGCGCGGC
TTCATCTACTACCTCTCGCGGCCGGCCATCAAGTTCATCCAGGACCTGGTGGAGGAGCAGGGCAAGGCCAAGTCG
CACCACAAGCCGCCCAAGGCGGCCTCGACAACGGGGGCCTCGACGCCCAGCCAGGGCGGCGGCGGCGGCGCGGCG
GAGAGGGACGCGGCGCACGAGCTCGAGGACCGCATCAAGGGCATCCTCAACCACCACCACAACAACCACAATAAC
AATAACAACAACTACAACGACGGGCGGCCCTACTCGACAAGCACCAGCTTCGAGGCCAACGGGGACGGGACCTGC
GCCTCCATCGAAGACCTGGAGAGCGGCATCTCGAAGGAGTACAGCCCCCAGCGCGGCTACCACGTGCGGCTGATC
GGGCCGCAGATCCAGCTGCAGAGCGACAAGAACAAGAAGCACGTCGTCCTGGTGACGGCCAAGGGCATGGAGCTC
AAGGTGCTCGAGGTCATGGACAAGCAGCGGATCTCGGACACGGTCAGCGGCCTGGTGCAGCGCCGGTTCCTCGTC
AGCATGGACAGCACGCAGTTCTTCGTCACGCACCAGAAGTGGTTCTCGACCAACCTGGTGTCCATGTACGCCGGC
AGCCGGTACGGCACGCCCAGGGGCTCGTCGTGGCCGCCGTGGGTGCCGATGGAGATCATGTTCAGCTTCACGGCC
GACCACCCGGTCGGCTTCCGGCGCGTCGTCCAGAAGACGTCGGCCCGGCTCCGGTACGACAAGTACAACAACCTG
CGGCTCAAGTACAACGACGAGGTCAACACGGACGAGGGGCCGGCGGCGGCGGCGACGGCGGCGACGGCTGCGGGC
GGCGAGCCGGCGGCGGACGGCGGAGCGGCCGCCGAGTGCCGCTCCGACAACGTCTGGGTCGAGTTCCCGCAGGCC
AGGGCGCTCTGCAACTCGTCGCAGTACTACGCCATGTACGTCATCGTGCTGGACCTTCTCATGTACAGCGAGCCG
CTGGAGAAGACGCGCAGCGAGCGGCTGGAGAAGATCATGCTCGCGTCCGACTTCAGCGACCTCAGCGGCGCGCCG
CAGATGGTGCTGAAGCTGCAGCAGCGGATCAAGCAGATCGAGGAGATCAAGAGCCACTTCCAGGTCTACTCCAGC
TACCTCGACCTGCGGGGTTGGGAGGACCGGCTGGCGCTGGAGCGGGACCTGGCCGCGTGCGAGGACGAGCTCTTC
TTCATGATGAAGGCCATCACGACGGCGCAGAGGAAGTACGAGGTGGACAGCGAGAGCGACGCCAACGCGCTGCTG
CGGTGGAACATCTCGGCGCACGAGATTGTGTGGCACCTGATGCAGGACTCGAACGAGGCGCTGGTCGAGCTGCAG
CTCAAGGACGTCGAGTACGACCGGACGGACAACTCGGACGGCTCGCACGCGAACCTGATTCGCGTCGGCAAGGTG
CTGGGCCTCAACCTGCTGCAGGACGCGACGTACCCGGAGATCATCGGGCCCTACCACGGCGAGGACAAGACGTGG
CCGGCGCAGGGCGGGCTGCTCGGGGACGGCGGCAGCGACATGATCCGGGTCTACTGGCACATGCTCGAGGCGATC
GCTGGGATCCCCGTCATGGACCGGTTCGAGGTGAACCTGTTCCCGATGAGGATCCAGCTGGAGCGCGAGGCCGGC
AAGCGCATCTTCAGCTACATCTTCCCCGGTATGGACGGGGAGAAGGGGCCGTCGGGGTCGGGGTCGGGGTCGGGG
CGGAACAACTCGCCGTACATGATCAAGCACGACATGGCCGCCGGCCAGGACGAGGACAGCGAGTCGCTGGCGAGC
TCGAGCAGCCGTCTGGGCACGCCGTCGATGGACAACGGCGCCGGCGGCGGCGGCCACCACCACGACTCGGCGGGC
TTCACGACCAAGGCGGGATCGCTGGAGCATCGGCTGCGGCCGACGCTGGCGTCGCACGGCCTGCAACACGACCGG
AGCCCCAAGAGGCCGCACGGCTCGGGCGGCCACCACCTGCCGCACCTCCACCACCACGGCAGCGTCAGCGGCGGC
GGCAGCGGCACCGGCGGCGAGGGCCACTCGTTCAAGCTGTTCCGGTCGGCCGGGACGGGCAAGACGATGCTGTCC
AAGAAGTCGTCGCACGACTCGCTCCGAGCAGCGGGGCCGGGGACGCGGGCCGGGAGCGTGTGCCGGTCGTCGACG
GGCCTCTCGTCCAAGGACGGGCGCGGCGGCGGCGGCGAGCACCACCTCCACCTCCACCATCACGGGTCGAACGAG
GGCAAGAAGGGCCCGGCGCGGTTCGGGCTGCGCGGCAAGGGGCAGGGCGGCGGCGGCGGCGACGACAAGCAGCAG
CAGCAGCAGTCGGACGACCTGAGCAAGATGATGACGCGGGCGAGCAACTACATGACGTTTGCGCACATCAAGATG
CCGTCGGTGGTGCTGTGCCTCAGCTACAAGGGCAAGGACCAGCGCAACTTTGAGGACGTGCACGACTTCGTCTTC
CGGCTGCCGACGATCGAAAGGCGGTGA
Gene >Hirsu2|9407
ATGGCCCTCCTGAACCCGACTTTCCTGCTCGGCCTCGTCGTCCTCACCTATCTGTCCTCCTTCGTCGTCTTCGCC
GTCATTCGAATCTTGACGGGCGTGTCGATCCAGCGCATCGGCTACCTCTCCCTGCGACGCATCGCCTACACGCCC
CGCGATGGCGTCCGCATCGAGCTTCGCAGCCTCGGCCTCAACATCCACCGGCCCACCTTTGCGCAGCCGACATGG
ATAAGCCTCGTCCTGAGCGAGTTGGTCGTCACCGTCGACATGAGCGAGCTCCAGGCGCGGAAACAGGCAGAGGCC
GGCCTCGGCCAGTCCTCCGAGTCCGAGTCCGTGCCGCTGTCCAAGACACCACCCTCGTGCCCCGACGCGCAGGCC
GCGTCCGGGGGTGAGGCCTGGAGGCAGGTGGCCAAGATCAAGGACAGGCTCAAGAGGCTGCACCGCAACATCAAG
TGGCTCCGCATGATCGACGTCGTCGCCACCAATTCCACCGTCAACGTCGTCGGCGTCGGCGACGTCCAGGTCGGC
AGCTTCACCGTCGCCGTCGACACGAGGCGCAAGATCGTCGACCACGCCCGTCTCTTCCACAAGCTGCACCCGCGC
AAGCGCGAGAACCGCCAGGCTGAGTGGATCTTCACCGTCCGGAGCCTCCTCTTCACCGCCGACGGGAAAGACTCG
CTCGAGGTGCTGGATCACGCGCTGCTCAACGTCCACGGCTTCCTCTACGAATCGCGCGACGGCTTGCGCGACGCC
ACCGTCGCCCTCAAGCTGGGCAGGGTCCACGTGCCGTACGACGACATCCAACAGTGCGCCGCCAAGCTCAAGCAG
CTGCGCCGCGGCCCCAAGACCCTCGCCGCCGAGGCGCCGAGGCGCGACCTCCTCATGGGCCCCGTCACGCTCGAG
GGCGACGGGGAGCCGGCCGGCAGGAACGACGACCTGATGCAGACAATCTCCGACTCCAAGGAGCTCTTCAGCTCC
ATCCTGCGCAACATCAAGGCCGTCCAGTTCGCCGTCAGCTTCGCCGGCCTGACCAAGAGGGTCACCTCGGTCAAG
CCGGCCTCGAGCCCCATCCTGCTCAACGCCTCGATGAAGGAGGTCGGCATCGACGTCCATCGCCTCAACCCCAAG
TCGCCCGCGCACCGCATGTACTTCCCGTCCACGGACATCGCCCACCAGGCCCTGGCCGCCGCCCTGTCCATCTCG
GTCGGCCTCGACGACGGCCACGGCAAGCCGGCCCGGCTGCTCTACATACCCATGGCCACCACCACCGCCCGCACG
ACGCTGCCCTCCAAGACGGTCCAGCTGGCGCACGACGGGAGCCTCGAGAAGAACGCCAACATCCTCTTCGCCAAC
TCCGTCGTCACCTCGCCCTCGGTCGACCTCGACCCCGGCCATCTGCCCCTCCTCATCGCCATGATGCAGCCGAAG
CCGAAGCCGCCCAAGGCCCATCACCAGAAGCGCCACCACCTCATCTCGCGCCTCCTCCCCAAGGCCAACGTCAAG
TTCTCCATGCACGAGCCCGTCGTCCGCATCAAGCTCCAGCCGCTGCAGGACACGGAAGACCCGGACGACTTCGAC
CTCATCATCTCCTCCATCTCGTCCGTCTCCCTCGACGTCGAGTCGTCCCACTCCTCCGTCGAGGACATGCACTAC
TTCCTCGACGGGGCCATGCGGCTGCAGTCCCACCGCCTCTACTACCAGACCTGCTCCGGCGAGATCCTGAACCTC
ATCACGACCGAGTCCCTCGACCTCAAGGCCCACCTGGGGGCCTCGCCCGACGTCTGCCTCGACGTCACCGGCCAC
ATACAGTCCGCCTCCGTCAGCATGGTCAGGCAGGAGATCACCGACGGCCTGCGCCAGATCGTCAGGCAGCTGCAC
ATCGACGTCGAGCCGGAAAAGCGGGCCAGCTCCAAGACGAGCAAGCACCAGAACTTCCTCCGCTCCATGCCCGAA
TGGCTCGTGCGCTACCACTTCGAGGCGTCCGACTTCACCGTCGAGGTCGCCGGCGTCGACGAGGACATCTCGGAC
GACACCAGGGGCATCTGCCTGCACCTCGACTCCTTCTCCGCCGAGTACCGCGCACACAGGCTGGACGGGCCCCAG
CGACGCCCACCCAGGAGGCGGACGCACAGCAGGTCCATCAACCAGTCCGACTCCGATCTTACCGCCTCGCCCTCG
TCGCCGAGGCTCAGGAGGAAGCCGCAGAACGTCGGCGACGGCCGCCGCCTCGCCCTGCATGCCCGCGGGCTCGAG
GTCCAGATCGTCGAGGCCGCGGATCGGCTCGAGGTCGAGCCCTTCGTCAGCATCCCTCGCCTCGAGCTCGCCTTC
TCGGCGTCCAGCGACAGCCACGGCCCCATGTTCCATATCCAGTCCCTGGTCCGCACCATCATGCTGCAGTATTCT
CTCTACCGACACTACTCCGTCGGCGTCGCCGTCATGACCCTGCGCAAGGCCTTCTTGAGGACCGGCCGGGACACC
CCGAGACCTCGCCAGCAGGGCACCTACCTCAGCCCCGACCGGATCCCTACGTCGCCCGGCGAACCCGAGGCCGAC
GGCGTCTCGACCATCACTCACGAGCTCCTGACCGTGGACATCAAGGCCTCCATGGTCCAGCTGAAGGCCGAGATG
CCCCATGAGCCGTTGCTGATGTTCCACGCCTTCGGCCTGGAAGGCGGCCGGCACAGGTGGTCGACCCCCTTCGCG
TCCTTCAAGCTCGCGCGCCTCTACGTGGAGCCTCCGCGCATGCGCCACGTTTGGGCCAAGCTCGTCAGCATCAAG
CACGGCCGAGTCGACCTGCGCGAGTCGAGGCACAAGACGTCACTGGGCGGCTTCGCCGAGGAGAAGATGATCGAC
GTCGCCACCGAAGCCATCCGGTTCGCGATCCCCCACGAAGTCATCTTCAGCCGAATCACGGACAACATCATCAAC
GTCTTCAAGGCCGTGCTGCAGTTGCATCACCGCTTCAAGACGGGGACGAACGAATACATCCTGGACAAGCACCCC
GAGGGCCCCAAACTGGTCCCCAAGATCTCCATCAGGTCGCGCAACTTCCTGTTCGAGCTCGAGGACGGCGCTTTC
GAGTGGAAACTGGGCATCATCTACCGCACCGGCCGCGTGGAACAGACGCAGAGGCTGGCGCGCGAGGAGGCTTTC
CGCGTCAAGTCGAATAGGGTGCGCGAGGAAGCGTCGAGACGGGGAAGCAAGGTCCGGTCGAGGTCGGCGCTGGCA
CGCGGCCGCACGGAAAACTCGTCGTCGTCTGCGTGGTTCAGGAGCCGAAGCCTCGACAGCTACCAGCCTGACGGC
CAGGGCGGCCTCGGCCGGTGGCCCATGCCGAGATACGACCCGGACGGCGAGAGCCAGGGAATCAACGGGCACGCC
AAGGTGTCCGAGGTCGAGGCACAAGCCCACCTGGACCTGCTCAACTCGCAGTCTTGGAAGAAGCGCATCGACCGC
GCCTACAAGGAGTCGCAGTCACGGACGAGGGACATGCGAGGAGCGTTCTGGGGCAACAGTTCGATCCCCGACGAC
GTCGAGGTGACCGAGAACATCCTCGAGGTGCCCCAGCGGCCCGCCCTCATGTCTCTCCTGGTGTCCGACCTCCAC
GTCACCCTGGACAAGCCGACCTTTGCGATGCGGGACCTGCCCGAGTTCATCCACAAGTACGGCAAGGGGATGCCG
CGCGACATGCTGTACACCCTCCTGATCCCCATGCACGTCGCCATCGGCATGGGCGAGGCGCGCATGTCGCTGCGC
GACTACCCGCTGCCCCTGCTGCACATCCCGGCCCTCAAGGCCGGGCAGTCGTCCAGGGTGCCGGCCGTGACGCTC
AAGACCAACTTCGTCATAGCCGAAGAGTTCCGGGGCCCCGAGTCGACGCGACGGATCATGGTCAACGTCATCCCG
CCGAGGAACAGGGACCCGGCCTCGTCCAACGAGGGCTGCTTCGCCATCGAGGTCCGGCGCACGGTCGGCGCCGTC
AAGTCGTACTCGGACGTCTACATGGACATCAACTCGGCCCTCCCCACCCGGGTCACATGGGGGCCCTGCTACCAG
CCGGCCATCCAGGACATGATGATGGTGATCGAGTCCTTCACGAAGCCCGTCGCGGACCCCTCGGAGCAGGTCGGC
TTCTGGGACAAGATCAGGCTCAGCTTCCACTCCCGCATCCACGTCGCCTGGAAGGGAGGCGGCGACATGCACCTC
TCCCTCAAGGGCAGCCGTGACCCGTACTACGTGCTGCGCGACGGCGCCGGCTTCCTGATGTGCTGGCGGAGCGAC
GTGCGGTGGAACATCAACACCGAGCCCGACCCGAAGCGGTTCATGACGGTCGACAGCGGCGAGTACATCCTGGCC
ATTCCCGACTTCAGCCATCTGGTCCGGGAGGCGACGGCCCGCCGCGAGGCGGACGACACCCCGGCCACGGACGGC
CCCTCCACGGACGGCCCCTCCACGGACGGGAGCCTCAAGGGAGGAGCGCAGTTCAAGAAGGTCGTGATGAAGCTC
TCGGGCAACGTCCGGTGGATGGCCGGGCTGGTGCTCGAGCGCGCCATCGTGGACGGGAAGCGCAGCTTCGAGTTC
AAGCCTCACTACGACGTCATCCTGAAGAACCCCCTCTACGCCAAGTCGGAGCCGGGCCTGCCCTACGACGCCTTC
CGGGGGTTCCGGAGCCGGCACATCCACATGTCCATCGCCGTGCGGTCGCCGGCGGACCGCGCGTGGACGTCCCAC
GACCCGGAGCCGTCCGGGAGCTACAACTCGGTGCACCTGACGCCCCGGTTCTTCACGCACTTCTTCCAGTGGTGG
GGGCTGTTCAGCGGGCCCATGTCGCTGCCGATCCGGTCGGGCAACCTGTTCCCGGGGCGCGAGAAGAACAGCAAG
AAGTTCGGCCGACACCTGGCGACGGTCAAGTACAACCTGCTGCTGGCGCCGCTCTTCCTCAGCCACATCTACAAG
CACAAGGACGCCGAGGACTACTCGGAGAACTCCGTGTCGGCGACGGGCCTCAAGATCCGCTTCGACAGCTTCATG
CTCGACCTGCACCAGCGGAGAGAGGAGTTCAACACGCTGGTCAAGGGCAAGAACACGCACAACAGGACGTCCGGC
ATCAAGATCCACGCGGCGCAGCTCGACCTGGCCAGCGCCGACATCCGGGCCGTCTCCGCCAGCCTGATGGGCACG
ACGACCGAGGCCATCAAGAAGGGCTCCATCGCGGCGCTCATCACGGAGCAGGACGACAAGCCCGACCTGTCCAAG
TTCACGATCCCGGACCACGACCTGAGCTGGATCGACATGGACGACTTCGTCGAGCTGGACTGGATCCTGCCGACG
GAGCCGCACCCGGAGACCAAGATCATGCCGCTGGCCTACGCGCCGCGGCTGACGTACTTCCGCCAGACGGACATC
GGCGGCACCATCGGCGGCGACCCGACGCGGACGAGCCCCTTCGGCAACGAGCCGACGCACTTCTGCCTGATGACG
CACGACGACGACCCGAAGCTGGTGCAGGCCCGGCTGATCCAGGAGCGGCTCGACCAGCTCGAGGAGCAGATGCTG
ACGCACTCGAGAGCCGTGGGCGAGGCCGAGCTCAAGGTGATCCAGACCAACTCGCAGGACCACGACATGGTCGAG
GTGCTCGAGACGCTGAGGAGGCACACCGGCGTGCTCAAGGAGAAGAAGGCCTTCCTGGAGAACATGCTGGAGCAG
ATGAACGCGCCGTCGCCCGCGGGCGGCAGCAGCGAGGACGGCGGGAGGAAGCGGTCCGGGGCGTCGTCGCGGGCC
AGCGACGGCGTCCTCAACATCCCGTCGACGGCCGAGTTCGAGAGCGACTTTGAGAACCGGTTCGTGATCCACAAC
ATGCAGCTCAAGTGGAACAACCTGCTGCGCAACATCGTGCTGCGCTACATCCACCAGAACGGCCAGCGGCGCGGC
TTCATCTACTACCTCTCGCGGCCGGCCATCAAGTTCATCCAGGACCTGGTGGAGGAGCAGGGCAAGGCCAAGTCG
CACCACAAGCCGCCCAAGGCGGCCTCGACAACGGGGGCCTCGACGCCCAGCCAGGGCGGCGGCGGCGGCGCGGCG
GAGAGGGACGCGGCGCACGAGCTCGAGGACCGCATCAAGGGCATCCTCAACCACCACCACAACAACCACAATAAC
AATAACAACAACTACAACGACGGGCGGCCCTACTCGACAAGCACCAGCTTCGAGGCCAACGGGGACGGGACCTGC
GCCTCCATCGAAGACCTGGAGAGCGGCATCTCGAAGGAGTACAGCCCCCAGCGCGGCTACCACGTGCGGCTGATC
GGGCCGCAGATCCAGCTGCAGAGCGACAAGAACAAGAAGCACGTCGTCCTGGTGACGGCCAAGGGCATGGAGCTC
AAGGTGCTCGAGGTCATGGACAAGCAGCGGATCTCGGACACGGTCAGCGGCCTGGTGCAGCGCCGGTTCCTCGTC
AGCATGGACAGCACGCAGTTCTTCGTCACGCACCAGAAGTGGTTCTCGACCAACCTGGTGTCCATGTACGCCGGC
AGCCGGTACGGCACGCCCAGGGGCTCGTCGTGGCCGCCGTGGGTGCCGATGGAGATCATGTTCAGCTTCACGGCC
GACCACCCGGTCGGCTTCCGGCGCGTCGTCCAGAAGACGTCGGCCCGGCTCCGGTACGACAAGTACAACAACCTG
CGGCTCAAGTACAACGACGAGGTCAACACGGACGAGGGGCCGGCGGCGGCGGCGACGGCGGCGACGGCTGCGGGC
GGCGAGCCGGCGGCGGACGGCGGAGCGGCCGCCGAGTGCCGCTCCGACAACGTCTGGGTCGAGTTCCCGCAGGCC
AGGGCGCTCTGCAACTCGTCGCAGTACTACGCCATGTACGTCATCGTGCTGGACCTTCTCATGTACAGCGAGCCG
CTGGAGAAGACGCGCAGCGAGCGGCTGGAGAAGATCATGCTCGCGTCCGACTTCAGCGACCTCAGCGGCGCGCCG
CAGATGGTGCTGAAGCTGCAGCAGCGGATCAAGCAGATCGAGGAGATCAAGAGCCACTTCCAGGTCTACTCCAGC
TACCTCGACCTGCGGGGTTGGGAGGACCGGCTGGCGCTGGAGCGGGACCTGGCCGCGTGCGAGGACGAGCTCTTC
TTCATGATGAAGGCCATCACGACGGCGCAGAGGAAGTACGAGGTGGACAGCGAGAGCGACGCCAACGCGCTGCTG
CGGTGGAACATCTCGGCGCACGAGATTGTGTGGCACCTGATGCAGGACTCGAACGAGGCGCTGGTCGAGCTGCAG
CTCAAGGACGTCGAGTACGACCGGACGGACAACTCGGACGGCTCGCACGCGAACCTGATTCGCGTCGGCAAGGTG
CTGGGCCTCAACCTGCTGCAGGACGCGACGTACCCGGAGATCATCGGGCCCTACCACGGCGAGGACAAGACGTGG
CCGGCGCAGGGCGGGCTGCTCGGGGACGGCGGCAGCGACATGATCCGGGTCTACTGGCACATGCTCGAGGCGATC
GCTGGGATCCCCGTCATGGACCGGTTCGAGGTGAACCTGTTCCCGATGAGGATCCAGCTGGAGCGCGAGGCCGGC
AAGCGCATCTTCAGCTACATCTTCCCCGGTATGGACGGGGAGAAGGGGCCGTCGGGGTCGGGGTCGGGGTCGGGG
CGGAACAACTCGCCGTACATGATCAAGCACGACATGGCCGCCGGCCAGGACGAGGACAGCGAGTCGCTGGCGAGC
TCGAGCAGCCGTCTGGGCACGCCGTCGATGGACAACGGCGCCGGCGGCGGCGGCCACCACCACGACTCGGCGGGC
TTCACGACCAAGGCGGGATCGCTGGAGCATCGGCTGCGGCCGACGCTGGCGTCGCACGGCCTGCAACACGACCGG
AGCCCCAAGAGGCCGCACGGCTCGGGCGGCCACCACCTGCCGCACCTCCACCACCACGGCAGCGTCAGCGGCGGC
GGCAGCGGCACCGGCGGCGAGGGCCACTCGTTCAAGCTGTTCCGGTCGGCCGGGACGGGCAAGACGATGCTGTCC
AAGAAGTCGTCGCACGACTCGCTCCGAGCAGCGGGGCCGGGGACGCGGGCCGGGAGCGTGTGCCGGTCGTCGACG
GGCCTCTCGTCCAAGGACGGGCGCGGCGGCGGCGGCGAGCACCACCTCCACCTCCACCATCACGGGTCGAACGAG
GGCAAGAAGGGCCCGGCGCGGTTCGGGCTGCGCGGCAAGGGGCAGGGCGGCGGCGGCGGCGACGACAAGCAGCAG
CAGCAGCAGTCGGACGACCTGAGCAAGATGATGACGCGGGCGAGCAACTACATGACGTTTGCGCACATCAAGATG
CCGTCGGTGGTGCTGTGCCTCAGCTACAAGGGCAAGGACCAGCGCAACTTTGAGGACGTGCACGACTTCGTCTTC
CGGCTGCCGACGATCGAGTGGCAGAACAAGACGTGGTCGAACCTGGACCTGGCGCTGGCGCTCAAGAAGGCGGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail