Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9395
Gene name
LocationContig_68:29811..30495
Strand-
Gene length (bp)684
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05175 MTS Methyltransferase small domain 7.3E-13 54 177
PF13649 Methyltransf_25 Methyltransferase domain 1.5E-09 67 159
PF13847 Methyltransf_31 Methyltransferase domain 7.1E-09 63 198
PF08241 Methyltransf_11 Methyltransferase domain 6.8E-08 67 159
PF13489 Methyltransf_23 Methyltransferase domain 6.8E-07 62 181
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 7.9E-06 63 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q58338|Y928_METJA Putative protein methyltransferase MJ0928 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0928 PE=3 SV=1 29 181 2.0E-19
sp|Q1QUF2|RSMC_CHRSD Ribosomal RNA small subunit methyltransferase C OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rsmC PE=3 SV=1 63 182 9.0E-14
sp|A5UFI6|RSMC_HAEIG Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain PittGG) GN=rsmC PE=3 SV=1 67 182 7.0E-11
sp|Q0VP64|RSMC_ALCBS Ribosomal RNA small subunit methyltransferase C OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rsmC PE=3 SV=1 66 177 1.0E-10
sp|Q65S65|RSMC_MANSM Ribosomal RNA small subunit methyltransferase C OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rsmC PE=3 SV=1 29 182 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q58338|Y928_METJA Putative protein methyltransferase MJ0928 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0928 PE=3 SV=1 29 181 2.0E-19
sp|Q1QUF2|RSMC_CHRSD Ribosomal RNA small subunit methyltransferase C OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rsmC PE=3 SV=1 63 182 9.0E-14
sp|A5UFI6|RSMC_HAEIG Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain PittGG) GN=rsmC PE=3 SV=1 67 182 7.0E-11
sp|Q0VP64|RSMC_ALCBS Ribosomal RNA small subunit methyltransferase C OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rsmC PE=3 SV=1 66 177 1.0E-10
sp|Q65S65|RSMC_MANSM Ribosomal RNA small subunit methyltransferase C OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rsmC PE=3 SV=1 29 182 4.0E-10
sp|Q4QPN2|RSMC_HAEI8 Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain 86-028NP) GN=rsmC PE=3 SV=1 30 182 1.0E-09
sp|Q9CM79|RSMC_PASMU Ribosomal RNA small subunit methyltransferase C OS=Pasteurella multocida (strain Pm70) GN=rsmC PE=3 SV=1 29 182 4.0E-09
sp|P44453|RSMC_HAEIN Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rsmC PE=3 SV=1 67 182 4.0E-09
sp|A3N3U3|RSMC_ACTP2 Ribosomal RNA small subunit methyltransferase C OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rsmC PE=3 SV=1 29 207 4.0E-09
sp|B3GZF1|RSMC_ACTP7 Ribosomal RNA small subunit methyltransferase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rsmC PE=3 SV=1 29 207 8.0E-09
sp|A4SIE3|RSMC_AERS4 Ribosomal RNA small subunit methyltransferase C OS=Aeromonas salmonicida (strain A449) GN=rsmC PE=3 SV=1 32 182 1.0E-08
sp|A5UBC5|RSMC_HAEIE Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain PittEE) GN=rsmC PE=3 SV=1 67 182 2.0E-08
sp|A0KPP9|RSMC_AERHH Ribosomal RNA small subunit methyltransferase C OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rsmC PE=3 SV=1 65 182 2.0E-08
sp|B0BU33|RSMC_ACTPJ Ribosomal RNA small subunit methyltransferase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rsmC PE=3 SV=1 29 207 6.0E-08
sp|P45253|PRMC_HAEIN Release factor glutamine methyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prmC PE=3 SV=1 66 177 8.0E-08
sp|A9MRB9|RSMC_SALAR Ribosomal RNA small subunit methyltransferase C OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rsmC PE=3 SV=1 67 207 9.0E-08
sp|A8ALZ1|RSMC_CITK8 Ribosomal RNA small subunit methyltransferase C OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rsmC PE=3 SV=1 67 213 1.0E-07
sp|Q5R049|RSMC_IDILO Ribosomal RNA small subunit methyltransferase C OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rsmC PE=3 SV=1 2 173 2.0E-07
sp|P26236|BCHM_RHOCA Magnesium-protoporphyrin O-methyltransferase OS=Rhodobacter capsulatus GN=bchM PE=1 SV=1 55 129 2.0E-07
sp|B4T4F9|RSMC_SALNS Ribosomal RNA small subunit methyltransferase C OS=Salmonella newport (strain SL254) GN=rsmC PE=3 SV=1 67 213 3.0E-07
sp|B4TGY8|RSMC_SALHS Ribosomal RNA small subunit methyltransferase C OS=Salmonella heidelberg (strain SL476) GN=rsmC PE=3 SV=1 67 213 3.0E-07
sp|Q5PK16|RSMC_SALPA Ribosomal RNA small subunit methyltransferase C OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rsmC PE=3 SV=1 67 213 4.0E-07
sp|B5BL07|RSMC_SALPK Ribosomal RNA small subunit methyltransferase C OS=Salmonella paratyphi A (strain AKU_12601) GN=rsmC PE=3 SV=1 67 213 4.0E-07
sp|B5FTB3|RSMC_SALDC Ribosomal RNA small subunit methyltransferase C OS=Salmonella dublin (strain CT_02021853) GN=rsmC PE=3 SV=1 67 213 4.0E-07
sp|B5R2I6|RSMC_SALEP Ribosomal RNA small subunit methyltransferase C OS=Salmonella enteritidis PT4 (strain P125109) GN=rsmC PE=3 SV=1 67 213 4.0E-07
sp|Q748B2|PRMC_GEOSL Release factor glutamine methyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=prmC PE=3 SV=1 19 177 4.0E-07
sp|B5F512|RSMC_SALA4 Ribosomal RNA small subunit methyltransferase C OS=Salmonella agona (strain SL483) GN=rsmC PE=3 SV=1 67 213 4.0E-07
sp|B4TU29|RSMC_SALSV Ribosomal RNA small subunit methyltransferase C OS=Salmonella schwarzengrund (strain CVM19633) GN=rsmC PE=3 SV=1 67 213 4.0E-07
sp|A9N7C4|RSMC_SALPB Ribosomal RNA small subunit methyltransferase C OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rsmC PE=3 SV=1 67 213 4.0E-07
sp|Q8ZJW6|RSMC_SALTY Ribosomal RNA small subunit methyltransferase C OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rsmC PE=3 SV=1 67 213 4.0E-07
sp|Q8Z0V2|RSMC_SALTI Ribosomal RNA small subunit methyltransferase C OS=Salmonella typhi GN=rsmC PE=3 SV=1 67 182 5.0E-07
sp|B5R9T9|RSMC_SALG2 Ribosomal RNA small subunit methyltransferase C OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rsmC PE=3 SV=1 67 213 5.0E-07
sp|Q57G51|RSMC_SALCH Ribosomal RNA small subunit methyltransferase C OS=Salmonella choleraesuis (strain SC-B67) GN=rsmC PE=3 SV=1 67 213 7.0E-07
sp|Q7VP87|RSMC_HAEDU Ribosomal RNA small subunit methyltransferase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rsmC PE=3 SV=1 67 207 8.0E-07
sp|Q0T8U3|RSMC_ECOL5 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rsmC PE=3 SV=1 67 213 1.0E-06
sp|B7MTB6|RSMC_ECO81 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O81 (strain ED1a) GN=rsmC PE=3 SV=1 67 213 1.0E-06
sp|B5Y286|RSMC_KLEP3 Ribosomal RNA small subunit methyltransferase C OS=Klebsiella pneumoniae (strain 342) GN=rsmC PE=3 SV=1 67 213 1.0E-06
sp|A1AJP2|RSMC_ECOK1 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O1:K1 / APEC GN=rsmC PE=3 SV=1 67 213 1.0E-06
sp|Q1R2D5|RSMC_ECOUT Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain UTI89 / UPEC) GN=rsmC PE=3 SV=1 67 213 1.0E-06
sp|A4W687|RSMC_ENT38 Ribosomal RNA small subunit methyltransferase C OS=Enterobacter sp. (strain 638) GN=rsmC PE=3 SV=1 67 154 2.0E-06
sp|Q820Z6|RSMC_SHIFL Ribosomal RNA small subunit methyltransferase C OS=Shigella flexneri GN=rsmC PE=3 SV=1 67 213 3.0E-06
sp|Q327M6|RSMC_SHIDS Ribosomal RNA small subunit methyltransferase C OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rsmC PE=3 SV=1 67 213 4.0E-06
sp|P39406|RSMC_ECOLI Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain K12) GN=rsmC PE=1 SV=3 67 213 4.0E-06
sp|B1XFI0|RSMC_ECODH Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain K12 / DH10B) GN=rsmC PE=3 SV=1 67 213 4.0E-06
sp|B7MNC1|RSMC_ECO45 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rsmC PE=3 SV=1 67 213 4.0E-06
sp|B7NH38|RSMC_ECOLU Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rsmC PE=3 SV=1 67 213 5.0E-06
sp|B7LEL6|RSMC_ECO55 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain 55989 / EAEC) GN=rsmC PE=3 SV=1 67 213 5.0E-06
sp|B1IS49|RSMC_ECOLC Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rsmC PE=3 SV=1 67 213 5.0E-06
sp|B5Z4Q2|RSMC_ECO5E Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rsmC PE=3 SV=1 67 213 5.0E-06
sp|Q8X510|RSMC_ECO57 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O157:H7 GN=rsmC PE=3 SV=1 67 213 5.0E-06
sp|B1LEH4|RSMC_ECOSM Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rsmC PE=3 SV=1 67 213 6.0E-06
sp|B7LNK6|RSMC_ESCF3 Ribosomal RNA small subunit methyltransferase C OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rsmC PE=3 SV=1 67 213 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7112 0.558 0.121 0.0675 0.1936 0.0399 0.0475 0.0597 0.0907 0.0054

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6314
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02455
Ophiocordyceps camponoti-rufipedis Ophun1|3752
Ophiocordyceps kimflemingae Ophio5|5638
Ophiocordyceps subramaniannii Hirsu2|9395 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9395
MASPRNEWEVRISELITESKKHEATYLEQIGEFQVYIHPSVYSPKYFPETLWYGTHLPSIVRGASFLEIGIGSGL
ISLHLAASGSEVSGVDINPNAVDVTRKSFKTNGRTGNFYVSDIFDNVSGTFDFIFWNHPWQFDASVTQELKSEKT
FDEGYRLLKRFISQAKDFLNPGGSILLGTSAYADLDAMASICEANGYSHDVIQKGKRSIGKNITEEYYIIELRPA
YV*
Coding >Hirsu2|9395
ATGGCCTCACCACGCAATGAATGGGAAGTACGCATCAGTGAGCTCATTACAGAGTCCAAGAAGCACGAGGCGACG
TATCTCGAGCAAATTGGAGAGTTCCAGGTCTACATCCACCCCTCAGTGTACTCGCCAAAATACTTCCCCGAGACG
CTTTGGTACGGGACCCATCTCCCCTCGATTGTCCGAGGAGCATCTTTTCTCGAGATAGGCATTGGCTCCGGTCTC
ATCTCCCTTCACCTGGCTGCGTCCGGCTCCGAGGTGTCCGGGGTCGACATTAACCCCAATGCTGTCGACGTCACT
CGGAAGAGCTTCAAGACCAACGGCCGGACGGGCAACTTCTATGTGAGCGACATCTTCGACAACGTATCGGGCACA
TTCGACTTCATCTTCTGGAACCACCCGTGGCAGTTCGATGCAAGCGTGACACAGGAGCTCAAGTCGGAAAAGACG
TTTGACGAGGGGTACCGCCTCTTGAAGCGGTTCATTTCCCAGGCCAAGGACTTCCTGAACCCGGGCGGTTCCATC
TTACTGGGCACCAGCGCCTACGCTGATTTAGATGCGATGGCGAGCATTTGTGAGGCCAACGGCTATTCCCACGAC
GTCATCCAGAAGGGAAAGCGCTCGATTGGCAAGAACATTACCGAGGAATACTACATCATTGAGCTACGGCCGGCC
TACGTATAA
Transcript >Hirsu2|9395
ATGGCCTCACCACGCAATGAATGGGAAGTACGCATCAGTGAGCTCATTACAGAGTCCAAGAAGCACGAGGCGACG
TATCTCGAGCAAATTGGAGAGTTCCAGGTCTACATCCACCCCTCAGTGTACTCGCCAAAATACTTCCCCGAGACG
CTTTGGTACGGGACCCATCTCCCCTCGATTGTCCGAGGAGCATCTTTTCTCGAGATAGGCATTGGCTCCGGTCTC
ATCTCCCTTCACCTGGCTGCGTCCGGCTCCGAGGTGTCCGGGGTCGACATTAACCCCAATGCTGTCGACGTCACT
CGGAAGAGCTTCAAGACCAACGGCCGGACGGGCAACTTCTATGTGAGCGACATCTTCGACAACGTATCGGGCACA
TTCGACTTCATCTTCTGGAACCACCCGTGGCAGTTCGATGCAAGCGTGACACAGGAGCTCAAGTCGGAAAAGACG
TTTGACGAGGGGTACCGCCTCTTGAAGCGGTTCATTTCCCAGGCCAAGGACTTCCTGAACCCGGGCGGTTCCATC
TTACTGGGCACCAGCGCCTACGCTGATTTAGATGCGATGGCGAGCATTTGTGAGGCCAACGGCTATTCCCACGAC
GTCATCCAGAAGGGAAAGCGCTCGATTGGCAAGAACATTACCGAGGAATACTACATCATTGAGCTACGGCCGGCC
TACGTATAA
Gene >Hirsu2|9395
ATGGCCTCACCACGCAATGAATGGGAAGTACGCATCAGTGAGCTCATTACAGAGTCCAAGAAGCACGAGGCGACG
TATCTCGAGCAAATTGGAGAGTTCCAGGTCTACATCCACCCCTCAGTGTACTCGCCAAAATACTTCCCCGAGACG
CTTTGGTACGGGACCCATCTCCCCTCGATTGTCCGAGGAGCATCTTTTCTCGAGATAGGCATTGGCTCCGGTCTC
ATCTCCCTTCACCTGGCTGCGTCCGGCTCCGAGGTGTCCGGGGTCGACATTAACCCCAATGCTGTCGACGTCACT
CGGAAGAGCTTCAAGACCAACGGCCGGACGGGCAACTTCTATGTGAGCGACATCTTCGACAACGTATCGGGCACA
TTCGACTTCATCTTCTGGAACCACCCGTGGCAGTTCGATGCAAGCGTGACACAGGAGCTCAAGTCGGAAAAGACG
TTTGACGAGGGGTACCGCCTCTTGAAGCGGTTCATTTCCCAGGCCAAGGACTTCCTGAACCCGGGCGGTTCCATC
TTACTGGGCACCAGCGCCTACGCTGATTTAGATGCGATGGCGAGCATTTGTGAGGCCAACGGCTATTCCCACGAC
GTCATCCAGAAGGGAAAGCGCTCGATTGGCAAGAACATTACCGAGGAATACTACATCATTGAGCTACGGCCGGCC
TACGTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail