Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9391
Gene name
LocationContig_68:24109..25478
Strand+
Gene length (bp)1369
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.8E-21 25 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 1 349 5.0E-44
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 7 394 3.0E-43
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 25 296 3.0E-15
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 11 204 6.0E-08
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 28 235 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 1 349 5.0E-44
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 7 394 3.0E-43
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 25 296 3.0E-15
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 11 204 6.0E-08
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 28 235 5.0E-07
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 28 235 9.0E-07
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 25 251 2.0E-06
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 28 235 2.0E-06
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 20 212 3.0E-06
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 28 235 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular Signal peptide 0.4748 0.1856 0.6931 0.1167 0.3508 0.0243 0.1865 0.2446 0.1055 0.1184

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 1.0E-46 23 210

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup133
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7793
Ophiocordyceps australis map64 (Brazil) OphauB2|5097
Ophiocordyceps camponoti-floridani Ophcf2|00778
Ophiocordyceps camponoti-floridani Ophcf2|03867
Ophiocordyceps camponoti-rufipedis Ophun1|5948
Ophiocordyceps camponoti-rufipedis Ophun1|6363
Ophiocordyceps kimflemingae Ophio5|1641
Ophiocordyceps kimflemingae Ophio5|2605
Ophiocordyceps kimflemingae Ophio5|3904
Ophiocordyceps subramaniannii Hirsu2|10680
Ophiocordyceps subramaniannii Hirsu2|1755
Ophiocordyceps subramaniannii Hirsu2|6804
Ophiocordyceps subramaniannii Hirsu2|9391 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9391
MWDQFTNYSCMPDPADAPCSGQGYPPYVVDAYTAEHVKVGIEFAREHRLRLVVKNTGHDFLGRSIGPGALSIWTH
HLKTIEFHPGGFELAGSGQIIRGNAMTLGGGVQLFEAYQAADKYGQTIVGGNGRSVGIGGYIAGGGHSFLSPHFG
LGVDNVLQMEVVTPMGQILMVNEHRYPDLFWALRGGGGSTFGVITKVTMSTHPKLHVTNVLWKVIVAPKAPYRWD
VVSYVASKLPYLIDSGLSGANFIDGNISNSNTAHGLPYTVAGMTGRNIAIDKDGKTVDKIFKPIKDTLDARWPGK
AFLSVETKEYGDFFAWYKENYDHSTGGYSRYLVSRLLDKRVLEGDVKALKPALKAGSEPNALFGLYAVGGKGVRN
AKPRGGNSVHPAWRKAYVHTGRCSIQLS*
Coding >Hirsu2|9391
ATGTGGGATCAGTTCACCAACTACTCTTGCATGCCGGATCCTGCCGATGCACCGTGTAGTGGCCAGGGGTATCCT
CCGTATGTCGTCGACGCATACACGGCGGAGCACGTCAAGGTTGGCATCGAGTTTGCTCGTGAGCATCGCCTCAGG
CTTGTCGTCAAGAACACGGGTCACGACTTTCTCGGCCGTTCCATCGGCCCGGGAGCGCTGTCGATCTGGACGCAC
CATCTAAAGACGATCGAGTTCCACCCGGGTGGCTTCGAGCTCGCCGGTTCCGGCCAGATAATTCGTGGTAACGCC
ATGACTCTAGGCGGAGGAGTCCAGCTATTCGAAGCCTACCAGGCTGCCGACAAGTACGGCCAGACCATTGTAGGA
GGCAACGGAAGGTCGGTAGGAATCGGCGGCTACATTGCAGGCGGTGGCCACTCGTTCTTGTCTCCTCATTTTGGC
CTTGGCGTGGATAACGTTCTGCAAATGGAGGTCGTCACTCCCATGGGACAGATTCTCATGGTCAACGAACACCGC
TATCCTGACCTCTTCTGGGCCCTGCGAGGTGGCGGCGGCTCAACCTTTGGCGTCATCACTAAAGTGACCATGTCC
ACGCATCCCAAGCTGCACGTCACCAACGTGCTCTGGAAGGTTATCGTTGCTCCTAAAGCGCCGTACCGATGGGAT
GTGGTTTCGTACGTCGCGTCTAAGTTGCCATATCTCATCGACTCAGGACTTTCGGGGGCGAATTTCATCGACGGA
AACATCTCCAATTCTAACACGGCGCACGGTCTGCCCTATACGGTTGCGGGAATGACCGGCAGAAACATCGCCATT
GATAAAGATGGCAAGACGGTAGACAAGATTTTCAAGCCGATCAAAGACACTCTGGATGCACGGTGGCCGGGCAAG
GCGTTCCTCTCTGTCGAGACCAAGGAGTACGGCGACTTCTTTGCTTGGTACAAGGAGAACTACGACCACAGCACC
GGCGGCTACAGCCGGTACCTTGTGTCTCGTCTGCTGGACAAGAGGGTTCTCGAGGGTGACGTGAAGGCTCTGAAG
CCTGCTTTGAAGGCGGGCAGTGAGCCTAATGCCCTCTTTGGTCTTTATGCCGTCGGTGGGAAGGGCGTTCGAAAT
GCGAAACCTCGGGGAGGAAACTCCGTTCATCCGGCGTGGCGCAAGGCCTACGTTCATACGGGTAGGTGCTCCATT
CAGCTGAGCTGA
Transcript >Hirsu2|9391
ATGTGGGATCAGTTCACCAACTACTCTTGCATGCCGGATCCTGCCGATGCACCGTGTAGTGGCCAGGGGTATCCT
CCGTATGTCGTCGACGCATACACGGCGGAGCACGTCAAGGTTGGCATCGAGTTTGCTCGTGAGCATCGCCTCAGG
CTTGTCGTCAAGAACACGGGTCACGACTTTCTCGGCCGTTCCATCGGCCCGGGAGCGCTGTCGATCTGGACGCAC
CATCTAAAGACGATCGAGTTCCACCCGGGTGGCTTCGAGCTCGCCGGTTCCGGCCAGATAATTCGTGGTAACGCC
ATGACTCTAGGCGGAGGAGTCCAGCTATTCGAAGCCTACCAGGCTGCCGACAAGTACGGCCAGACCATTGTAGGA
GGCAACGGAAGGTCGGTAGGAATCGGCGGCTACATTGCAGGCGGTGGCCACTCGTTCTTGTCTCCTCATTTTGGC
CTTGGCGTGGATAACGTTCTGCAAATGGAGGTCGTCACTCCCATGGGACAGATTCTCATGGTCAACGAACACCGC
TATCCTGACCTCTTCTGGGCCCTGCGAGGTGGCGGCGGCTCAACCTTTGGCGTCATCACTAAAGTGACCATGTCC
ACGCATCCCAAGCTGCACGTCACCAACGTGCTCTGGAAGGTTATCGTTGCTCCTAAAGCGCCGTACCGATGGGAT
GTGGTTTCGTACGTCGCGTCTAAGTTGCCATATCTCATCGACTCAGGACTTTCGGGGGCGAATTTCATCGACGGA
AACATCTCCAATTCTAACACGGCGCACGGTCTGCCCTATACGGTTGCGGGAATGACCGGCAGAAACATCGCCATT
GATAAAGATGGCAAGACGGTAGACAAGATTTTCAAGCCGATCAAAGACACTCTGGATGCACGGTGGCCGGGCAAG
GCGTTCCTCTCTGTCGAGACCAAGGAGTACGGCGACTTCTTTGCTTGGTACAAGGAGAACTACGACCACAGCACC
GGCGGCTACAGCCGGTACCTTGTGTCTCGTCTGCTGGACAAGAGGGTTCTCGAGGGTGACGTGAAGGCTCTGAAG
CCTGCTTTGAAGGCGGGCAGTGAGCCTAATGCCCTCTTTGGTCTTTATGCCGTCGGTGGGAAGGGCGTTCGAAAT
GCGAAACCTCGGGGAGGAAACTCCGTTCATCCGGCGTGGCGCAAGGCCTACGTTCATACGGGTAGGTGCTCCATT
CAGCTGAGCTGA
Gene >Hirsu2|9391
ATGTGGGATCAGTTCACCAACTACTCTTGCATGCCGGATCCTGCCGATGCACCGTGTAGTGGCCAGGGGTATCCT
CCGTATGTCGTCGACGCATACACGGCGGAGCACGTCAAGGTTGGCATCGAGTTTGGTACGTCCTAATGGCTCTGG
CCAACTGTGCCGAGGCACGGTTCGTCCAGCCGTCTTACCGATACCGCAGCTCGTGAGCATCGCCTCAGGCTTGTC
GTCAAGAACACGGGTCACGACTTTCTCGGCCGTTCCATCGGCCCGGGAGCGCTGTCGATCTGGACGCACCATCTA
AAGACGATCGAGTTCCACCCGGGTGGCTTCGAGCTCGCCGGTTCCGGCCAGATAATTCGTGGTAACGCCATGACT
CTAGGCGGAGGAGTCCAGCTATTCGAAGCCTACCAGGCTGCCGACAAGTACGGCCAGACCATTGTAGGAGGCAAC
GGAAGGTCGGTAGGAATCGGCGGCTACATTGCAGGCGGTGGCCACTCGTTCTTGTCTCCTCATTTTGGCCTTGGC
GTGGATAACGTTCTGCAAATGGAGGTCGTCACTCCCATGGGACAGATTCTCATGGTCAACGAACACCGCTATCCT
GACCTCTTCTGGGCCCTGCGAGGTGTTCGTGAATAATCCTTTCCCCCGCATACGGCGTGCACGCAAGAGCTACAT
ATGCTGACTATGAAGCTCTCGACGCACGCAAAATCAGGGCGGCGGCTCAACCTTTGGCGTCATCACTAAAGTGAC
CATGTCCACGCATCCCAAGCTGCACGTCACCAACGTGCTCTGGAAGGTTATCGTTGCTCCTAAAGCGCCGTACCG
ATGGGATGTGGTTTCGTACGTCGCGTCTAAGTTGCCATATCTCATCGACTCAGGACTTTCGGGGGCGAATTTCAT
CGACGGAAACATCTCCAATTCTAACACGGCGCACGGTCTGCCCTATACGGTTGCGGGAATGACCGGCAGAAACAT
CGCCATTGATAAAGATGGCAAGACGGTAGACAAGATTTTCAAGCCGATCAAAGACACTCTGGATGCACGGTGGCC
GGGCAAGGCGTTCCTCTCTGTCGAGACCAAGGAGTACGGCGACTTCTTTGCTTGGTACAAGGAGAACTACGACCA
CAGCACCGGCGGCTACAGCCGGTACCTTGTGTCTCGTCTGCTGGACAAGAGGGTTCTCGAGGGTGACGTGAAGGC
TCTGAAGCCTGCTTTGAAGGCGGGCAGTGAGCCTAATGCCCTCTTTGGTCTTTATGCCGTCGGTGGGAAGGGCGT
TCGAAATGCGAAACCTCGGGGAGGAAACTCCGTTCATCCGGCGTGGCGCAAGGCCTACGTTCATACGGGTAGGTG
CTCCATTCAGCTGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail