Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9386
Gene name
LocationContig_68:9238..10920
Strand+
Gene length (bp)1682
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13813 MBOAT_2 Membrane bound O-acyl transferase family 3.5E-14 337 425

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 28 47 19
2 60 79 19
3 83 105 22
4 251 273 22
5 293 315 22
6 390 412 22
7 422 444 22
8 451 473 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9386
MDSLLEETRTSFRTSFLDGLADGRAKPFVIPFSALGSFIVPVVWLAIPHAHRPWLYRTRWIVAAFVVAFNLNVLR
WSSSANPGIAYVFGMATAWAAVMNLNHLLWTRPQLEAARALRKGPETVRRREAGDSAVSTGCAPWPPGASSERRI
EGKPCARSVEETGSADEAWVWQTFPADAGFLTRLGWAFDLATSIRGGGWNWAISSIPRPRIPARIGPGDAVDLTC
MPRRTPSGYEYCLTEGEFLRRRFIKILITYLAVDAVSVCVFRDPYFVVGPDRPYELPPHLRNMPPWLLLAYREML
ALVGMISSITLEYNMRDLNSYLVLKLFHPARFALWQYPSAFGSFSHVLDRGLSGWWGAWWHQSFRLSLLAPAKYF
SQYLPVERRSRVIDLFTLFASFAMSGSLHAVGSISTMAASKPWKTLLFFLIQAVGIVVQDALAMTIRAVVPKPPR
ALARATNFLFTLVFMYATAHLFLDDLASAGLCALDKIPVSPLKWLGLGTGKGHWWRWDYLGTPAWYSGKHWWESG
IFI*
Coding >Hirsu2|9386
ATGGACAGCCTCTTGGAGGAGACGCGAACCAGCTTTCGAACCTCATTCCTGGACGGGCTCGCCGATGGACGAGCC
AAGCCGTTCGTGATTCCGTTCAGCGCACTCGGCTCCTTCATCGTCCCCGTTGTCTGGCTCGCGATCCCGCACGCG
CACCGGCCCTGGCTCTACCGGACGCGATGGATCGTCGCCGCCTTCGTCGTCGCCTTCAACCTCAACGTGCTCCGT
TGGTCGTCGAGCGCGAACCCGGGCATCGCCTACGTCTTCGGCATGGCGACCGCCTGGGCCGCCGTCATGAACCTC
AACCATCTCCTCTGGACGAGGCCGCAGCTCGAGGCAGCGAGAGCGCTGCGGAAAGGCCCGGAGACGGTCCGGCGC
CGGGAGGCCGGCGACTCGGCCGTGTCCACCGGCTGCGCGCCGTGGCCTCCGGGCGCCTCGTCCGAGCGCAGGATC
GAGGGGAAGCCGTGTGCGCGGTCCGTAGAGGAGACGGGCTCTGCCGATGAGGCGTGGGTTTGGCAGACCTTCCCG
GCCGATGCTGGCTTTCTCACGCGTCTCGGCTGGGCGTTCGATCTGGCGACGAGCATTCGAGGCGGAGGCTGGAAC
TGGGCCATATCGTCGATCCCCCGGCCCCGTATCCCCGCGCGCATCGGGCCCGGAGACGCTGTAGATTTGACGTGC
ATGCCGCGCAGGACGCCAAGCGGGTACGAGTACTGCCTGACAGAAGGCGAGTTTCTCCGGAGGCGCTTCATCAAG
ATCCTCATCACCTACCTGGCCGTAGACGCCGTGTCCGTCTGCGTATTCAGAGACCCTTACTTCGTCGTCGGTCCG
GATCGTCCCTACGAGTTGCCGCCGCATCTTCGCAACATGCCGCCTTGGCTCCTGCTTGCATACCGAGAGATGCTG
GCCCTGGTCGGCATGATCAGCTCCATCACGCTTGAGTACAACATGCGCGACTTGAATTCGTACCTGGTACTCAAG
CTCTTTCACCCTGCCCGCTTCGCATTGTGGCAGTACCCCTCGGCCTTTGGATCCTTCTCGCATGTCCTGGACCGC
GGCCTGTCTGGATGGTGGGGAGCCTGGTGGCACCAGTCCTTTCGCCTGTCGCTTCTGGCCCCGGCCAAGTATTTC
TCTCAATACCTGCCGGTCGAGAGGCGTTCTCGCGTCATCGACCTCTTTACCTTGTTCGCCTCCTTTGCCATGTCC
GGCTCGCTTCACGCGGTCGGAAGCATATCAACAATGGCTGCCTCGAAGCCCTGGAAAACGCTCTTGTTCTTCCTC
ATCCAGGCCGTGGGCATCGTCGTCCAGGACGCCCTGGCTATGACCATCAGGGCAGTCGTCCCGAAGCCACCCCGG
GCGCTGGCGCGGGCGACCAACTTCCTCTTCACGCTGGTTTTCATGTACGCCACGGCGCATCTATTCCTCGACGAC
TTGGCTTCAGCCGGGCTATGCGCGCTCGACAAAATCCCAGTTTCCCCCCTGAAGTGGCTCGGTCTTGGAACCGGT
AAGGGCCATTGGTGGCGTTGGGACTACTTGGGCACTCCTGCTTGGTACTCTGGAAAACATTGGTGGGAGTCTGGG
ATCTTTATATGA
Transcript >Hirsu2|9386
ATGGACAGCCTCTTGGAGGAGACGCGAACCAGCTTTCGAACCTCATTCCTGGACGGGCTCGCCGATGGACGAGCC
AAGCCGTTCGTGATTCCGTTCAGCGCACTCGGCTCCTTCATCGTCCCCGTTGTCTGGCTCGCGATCCCGCACGCG
CACCGGCCCTGGCTCTACCGGACGCGATGGATCGTCGCCGCCTTCGTCGTCGCCTTCAACCTCAACGTGCTCCGT
TGGTCGTCGAGCGCGAACCCGGGCATCGCCTACGTCTTCGGCATGGCGACCGCCTGGGCCGCCGTCATGAACCTC
AACCATCTCCTCTGGACGAGGCCGCAGCTCGAGGCAGCGAGAGCGCTGCGGAAAGGCCCGGAGACGGTCCGGCGC
CGGGAGGCCGGCGACTCGGCCGTGTCCACCGGCTGCGCGCCGTGGCCTCCGGGCGCCTCGTCCGAGCGCAGGATC
GAGGGGAAGCCGTGTGCGCGGTCCGTAGAGGAGACGGGCTCTGCCGATGAGGCGTGGGTTTGGCAGACCTTCCCG
GCCGATGCTGGCTTTCTCACGCGTCTCGGCTGGGCGTTCGATCTGGCGACGAGCATTCGAGGCGGAGGCTGGAAC
TGGGCCATATCGTCGATCCCCCGGCCCCGTATCCCCGCGCGCATCGGGCCCGGAGACGCTGTAGATTTGACGTGC
ATGCCGCGCAGGACGCCAAGCGGGTACGAGTACTGCCTGACAGAAGGCGAGTTTCTCCGGAGGCGCTTCATCAAG
ATCCTCATCACCTACCTGGCCGTAGACGCCGTGTCCGTCTGCGTATTCAGAGACCCTTACTTCGTCGTCGGTCCG
GATCGTCCCTACGAGTTGCCGCCGCATCTTCGCAACATGCCGCCTTGGCTCCTGCTTGCATACCGAGAGATGCTG
GCCCTGGTCGGCATGATCAGCTCCATCACGCTTGAGTACAACATGCGCGACTTGAATTCGTACCTGGTACTCAAG
CTCTTTCACCCTGCCCGCTTCGCATTGTGGCAGTACCCCTCGGCCTTTGGATCCTTCTCGCATGTCCTGGACCGC
GGCCTGTCTGGATGGTGGGGAGCCTGGTGGCACCAGTCCTTTCGCCTGTCGCTTCTGGCCCCGGCCAAGTATTTC
TCTCAATACCTGCCGGTCGAGAGGCGTTCTCGCGTCATCGACCTCTTTACCTTGTTCGCCTCCTTTGCCATGTCC
GGCTCGCTTCACGCGGTCGGAAGCATATCAACAATGGCTGCCTCGAAGCCCTGGAAAACGCTCTTGTTCTTCCTC
ATCCAGGCCGTGGGCATCGTCGTCCAGGACGCCCTGGCTATGACCATCAGGGCAGTCGTCCCGAAGCCACCCCGG
GCGCTGGCGCGGGCGACCAACTTCCTCTTCACGCTGGTTTTCATGTACGCCACGGCGCATCTATTCCTCGACGAC
TTGGCTTCAGCCGGGCTATGCGCGCTCGACAAAATCCCAGTTTCCCCCCTGAAGTGGCTCGGTCTTGGAACCGGT
AAGGGCCATTGGTGGCGTTGGGACTACTTGGGCACTCCTGCTTGGTACTCTGGAAAACATTGGTGGGAGTCTGGG
ATCTTTATATGA
Gene >Hirsu2|9386
ATGGACAGCCTCTTGGAGGAGACGCGAACCAGCTTTCGAACCTCATTCCTGGACGGGCTCGCCGATGGACGAGCC
AAGCCGTTCGTGATTCCGTTCAGCGCACTCGGCTCCTTCATCGTCCCCGTTGTCTGGCTCGCGATCCCGCACGCG
CACCGGCCCTGGCTCTACCGGACGCGATGGATCGTCGCCGCCTTCGTCGTCGCCTTCAACCTCAACGTGCTCCGT
TGGTCGTCGAGCGCGAACCCGGGCATCGCCTACGTCTTCGGCATGGCGACCGCCTGGGCCGCCGTCATGAACCTC
AACCATCTCCTCTGGACGAGGCCGCAGCTCGAGGCAGCGAGAGCGCTGCGGAAAGGCCCGGAGACGGTCCGGCGC
CGGGAGGCCGGCGACTCGGCCGTGTCCACCGGCTGCGCGCCGTGGCCTCCGGGCGCCTCGTCCGAGCGCAGGATC
GAGGGGAAGCCGTGTGCGCGGTCCGTAGAGGAGACGGGCTCTGCCGATGAGGCGTGGGTTTGGCAGACCTTCCCG
GCCGATGCTGGCTTTCTCACGCGTCTCGGCTGGGCGTTCGATCTGGCGACGAGCATTCGAGGCGGAGGTAAGAGC
TGCGTCTGTGCCACCCCGAGAGATCCGGCTCCTTCGCCGCCCTCCGTGCGTGGGACCGGGCCGACAATTCTGACG
CTCTCTCGGCAGGCTGGAACTGGGCCATATCGTCGATCCCCCGGCCCCGTATCCCCGCGCGCATCGGGCCCGGAG
ACGCTGTAGATTTGACGTGCATGCCGCGCAGGACGCCAAGCGGGTACGAGTACTGCCTGACAGAAGGCGAGTTTC
TCCGGAGGCGCTTCATCAAGATCCTCATCACCTACCTGGCCGTAGACGCCGTGTCCGTCTGCGTATTCAGAGACC
CTTACTTCGTCGTCGGTCCGGATCGTCCCTACGAGTTGCCGCCGCATCTTCGCAACATGCCGCCTTGGCTCCTGC
TTGCATACCGAGAGATGCTGGCCCTGGTCGGCATGATCAGCTCCATCACGCTTGAGTACAACATGCGCGACTTGA
ATTCGTACCTGGTACTCAAGCTCTTTCACCCTGCCCGCTTCGCATTGTGGCAGTACCCCTCGGCCTTTGGATCCT
TCTCGCATGTCCTGGACCGCGGCCTGTCTGGATGGTGGGGAGCCTGGTGGCACCAGTCCTTTCGCCTGTCGCTTC
TGGCCCCGGCCAAGTATTTCTCTCAATACCTGCCGGTCGAGAGGCGTTCTCGCGTCATCGACCTCTTTACCTTGT
TCGCCTCCTTTGCCATGTCCGGCTCGCTTCACGCGGTCGGAAGCATATCAACAATGGCTGCCTCGAAGCCCTGGA
AAACGCTCTTGTTCTTCCTCATCCAGGCCGTGGGCATCGTCGTCCAGGACGCCCTGGCTATGACCATCAGGGCAG
TCGTCCCGAAGCCACCCCGGGCGCTGGCGCGGGCGACCAACTTCCTCTTCACGCTGGTTTTCATGTACGCCACGG
CGCATCTATTCCTCGACGACTTGGCTTCAGCCGGGCTATGCGCGCTCGACAAAATCCCAGTTTCCCCCCTGAAGT
GGCTCGGTCTTGGAACCGGTAAGGGCCATTGGTGGCGTTGGGACTACTTGGGCACTCCTGCTTGGTACTCTGGAA
AACATTGGTGGGAGTCTGGGATCTTTATATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail