Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9377
Gene name
LocationContig_679:1031..1953
Strand-
Gene length (bp)922
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07510 DUF1524 Protein of unknown function (DUF1524) 1.2E-08 87 194

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK18|A4619_ARTBC Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04619 PE=1 SV=2 1 199 8.0E-78

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9377
MKVLTALVLACAALAVPTPPGIPSPSTARTLLAGLEVAQPESGRGYSRKKFPHWETIRGTCNTREFVLERDGRNV
TVDDDCRAVSGSWESPYDGEVWTDAGDIDIDHMVPLKNAWISGAASWTTEQRRGFANDVTRPQLWAVTDSVNRAK
SDSSPDEWLPPLDGFRCTYVRSWIQVKSHYELSVTAEEKRAMAGVLDAC*
Coding >Hirsu2|9377
ATGAAGGTCTTGACGGCGCTCGTGCTCGCGTGCGCCGCGCTGGCGGTGCCGACGCCGCCCGGAATCCCGAGCCCG
TCGACGGCCCGCACGCTCCTGGCCGGGCTCGAGGTTGCGCAGCCGGAGAGCGGGCGCGGCTACAGCCGGAAGAAG
TTCCCGCACTGGGAGACGATCCGCGGGACGTGCAATACGCGCGAGTTCGTGCTGGAGCGAGACGGGCGCAACGTC
ACCGTTGATGACGACTGCCGGGCCGTGTCCGGCTCGTGGGAGAGCCCGTACGACGGCGAGGTGTGGACCGACGCC
GGCGACATCGACATCGACCACATGGTTCCGCTCAAGAACGCCTGGATCTCCGGCGCCGCGTCGTGGACGACGGAG
CAGCGGCGCGGCTTCGCCAACGACGTGACGCGGCCGCAGCTGTGGGCCGTCACCGACAGCGTCAACCGGGCCAAG
AGCGACAGCAGCCCCGACGAGTGGCTGCCGCCGCTCGACGGCTTCCGCTGCACCTACGTCCGCAGCTGGATCCAG
GTCAAGAGCCACTACGAGCTGTCGGTCACGGCCGAGGAGAAGCGGGCCATGGCCGGCGTCTTGGACGCGTGTTGA
Transcript >Hirsu2|9377
ATGAAGGTCTTGACGGCGCTCGTGCTCGCGTGCGCCGCGCTGGCGGTGCCGACGCCGCCCGGAATCCCGAGCCCG
TCGACGGCCCGCACGCTCCTGGCCGGGCTCGAGGTTGCGCAGCCGGAGAGCGGGCGCGGCTACAGCCGGAAGAAG
TTCCCGCACTGGGAGACGATCCGCGGGACGTGCAATACGCGCGAGTTCGTGCTGGAGCGAGACGGGCGCAACGTC
ACCGTTGATGACGACTGCCGGGCCGTGTCCGGCTCGTGGGAGAGCCCGTACGACGGCGAGGTGTGGACCGACGCC
GGCGACATCGACATCGACCACATGGTTCCGCTCAAGAACGCCTGGATCTCCGGCGCCGCGTCGTGGACGACGGAG
CAGCGGCGCGGCTTCGCCAACGACGTGACGCGGCCGCAGCTGTGGGCCGTCACCGACAGCGTCAACCGGGCCAAG
AGCGACAGCAGCCCCGACGAGTGGCTGCCGCCGCTCGACGGCTTCCGCTGCACCTACGTCCGCAGCTGGATCCAG
GTCAAGAGCCACTACGAGCTGTCGGTCACGGCCGAGGAGAAGCGGGCCATGGCCGGCGTCTTGGACGCGTGTTGA
Gene >Hirsu2|9377
ATGAAGGTCTTGACGGCGCTCGTGCTCGCGTGCGCCGCGCTGGCGGTGCCGACGCCGGTACGCCCCCCCGAGGCA
AAAAGGTCTCGGCCGGCAAGGCGCTGACGGTCGGTAGCCCGGAATCCCGAGCCCGTCGACGGCCCGCACGCTCCT
GGCCGGGCTCGAGGTTGCGCAGCCGGAGAGCGGGCGCGGCTACAGCCGGAAGAAGTTCCCGCACTGGGAGACGAT
CCGCGGGACGTGCAATACGCGGTGGGCCTTTTCCTCTCCTGCTGGCTCTTTTTTTTTTCTTCGCCATGGCTCCCT
GTCTGCTGGTGATCGGGCATGGGGGGGGGGGGGACGAGACGGCTTTCTGACCGGGGCCGGGGCCGAGTAGCGAGT
TCGTGCTGGAGCGAGACGGGCGCAACGTCACCGTTGATGACGACTGCCGGGCCGTGTCCGGCTCGTGGGAGAGCC
CGTACGACGGCGAGGTGTGGACCGACGCCGGCGACATCGACATCGACCACATGGTTCCGCTCAAGAACGCCTGGA
TCGTGCGTCTCTCCCGTCCCGTCTCTTGCTCTTCTCATCCCCTCGTCTCTGCCTCACCCCCTTCCCCCCCCTTTT
TTCGTCTTCACCTCGCACCCGGCTCTTGGTCGAGCAAGCAAAAAGACCTGACGGCTCACCTCCCCGCCAGTCCGG
CGCCGCGTCGTGGACGACGGAGCAGCGGCGCGGCTTCGCCAACGACGTGACGCGGCCGCAGCTGTGGGCCGTCAC
CGACAGCGTCAACCGGGCCAAGAGCGACAGCAGCCCCGACGAGTGGCTGCCGCCGCTCGACGGCTTCCGCTGCAC
CTACGTCCGCAGCTGGATCCAGGTCAAGAGCCACTACGAGCTGTCGGTCACGGCCGAGGAGAAGCGGGCCATGGC
CGGCGTCTTGGACGCGTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail