Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9370
Gene name
LocationContig_677:4463..10136
Strand-
Gene length (bp)5673
Transcript length (bp)5196
Coding sequence length (bp)5196
Protein length (aa) 1732

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08429 PLU-1 PLU-1-like protein 6.9E-109 913 1262
PF02373 JmjC JmjC domain, hydroxylase 5.2E-43 614 730
PF01388 ARID ARID/BRIGHT DNA binding domain 8.2E-21 167 251
PF00628 PHD PHD-finger 3.9E-10 442 487
PF00628 PHD PHD-finger 2.7E-07 1312 1357
PF02375 JmjN jmjN domain 1.5E-13 98 131
PF02928 zf-C5HC2 C5HC2 zinc finger 1.2E-09 840 897

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q62240|KDM5D_MOUSE Lysine-specific demethylase 5D OS=Mus musculus GN=Kdm5d PE=2 SV=2 96 1401 2.0E-149
sp|Q9BY66|KDM5D_HUMAN Lysine-specific demethylase 5D OS=Homo sapiens GN=KDM5D PE=1 SV=2 96 1406 1.0E-148
sp|Q5XUN4|KDM5D_PANTR Lysine-specific demethylase 5D OS=Pan troglodytes GN=KDM5D PE=2 SV=1 96 1406 2.0E-148
sp|Q9VMJ7|KDM5_DROME Lysine-specific demethylase lid OS=Drosophila melanogaster GN=lid PE=1 SV=1 96 1406 5.0E-148
sp|Q9HDV4|LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lid2 PE=1 SV=1 441 1516 8.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q62240|KDM5D_MOUSE Lysine-specific demethylase 5D OS=Mus musculus GN=Kdm5d PE=2 SV=2 96 1401 2.0E-149
sp|Q9BY66|KDM5D_HUMAN Lysine-specific demethylase 5D OS=Homo sapiens GN=KDM5D PE=1 SV=2 96 1406 1.0E-148
sp|Q5XUN4|KDM5D_PANTR Lysine-specific demethylase 5D OS=Pan troglodytes GN=KDM5D PE=2 SV=1 96 1406 2.0E-148
sp|Q9VMJ7|KDM5_DROME Lysine-specific demethylase lid OS=Drosophila melanogaster GN=lid PE=1 SV=1 96 1406 5.0E-148
sp|Q9HDV4|LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lid2 PE=1 SV=1 441 1516 8.0E-148
sp|Q5F3R2|KDM5B_CHICK Lysine-specific demethylase 5B OS=Gallus gallus GN=KDM5B PE=2 SV=1 96 1399 1.0E-141
sp|Q3UXZ9|KDM5A_MOUSE Lysine-specific demethylase 5A OS=Mus musculus GN=Kdm5a PE=1 SV=2 96 1187 3.0E-137
sp|Q9UGL1|KDM5B_HUMAN Lysine-specific demethylase 5B OS=Homo sapiens GN=KDM5B PE=1 SV=3 96 1164 8.0E-136
sp|Q9UT79|MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msc1 PE=3 SV=1 421 1484 3.0E-134
sp|Q80Y84|KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus GN=Kdm5b PE=1 SV=1 96 1096 3.0E-132
sp|Q30DN6|KDM5D_CANLF Lysine-specific demethylase 5D OS=Canis lupus familiaris GN=KDM5D PE=2 SV=1 442 1405 1.0E-113
sp|A1YVX4|KDM5C_PIG Lysine-specific demethylase 5C OS=Sus scrofa GN=KDM5C PE=2 SV=1 442 1405 2.0E-113
sp|P41229|KDM5C_HUMAN Lysine-specific demethylase 5C OS=Homo sapiens GN=KDM5C PE=1 SV=2 442 1405 4.0E-113
sp|Q38JA7|KDM5C_CANLF Lysine-specific demethylase 5C OS=Canis lupus familiaris GN=KDM5C PE=2 SV=1 442 1405 7.0E-113
sp|P41230|KDM5C_MOUSE Lysine-specific demethylase 5C OS=Mus musculus GN=Kdm5c PE=1 SV=4 442 1405 1.0E-112
sp|Q6IQX0|KD5BB_DANRE Lysine-specific demethylase 5B-B OS=Danio rerio GN=kdm5bb PE=2 SV=2 442 1374 2.0E-110
sp|P29375|KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens GN=KDM5A PE=1 SV=3 442 1187 3.0E-100
sp|Q9US53|JMJ2_SCHPO Jumonji/ARID domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=jmj2 PE=3 SV=1 415 887 2.0E-95
sp|Q23541|KDM5_CAEEL Lysine-specific demethylase rbr-2 OS=Caenorhabditis elegans GN=rbr-2 PE=1 SV=2 403 1094 7.0E-88
sp|Q61T02|KDM5_CAEBR Lysine-specific demethylase rbr-2 OS=Caenorhabditis briggsae GN=rbr-2 PE=3 SV=2 442 1093 1.0E-87
sp|C0SUT9|JMJ16_ARATH Putative lysine-specific demethylase JMJ16 OS=Arabidopsis thaliana GN=JMJ16 PE=2 SV=1 493 872 2.0E-79
sp|Q53WJ1|JM703_ORYSJ Lysine-specific demethylase JMJ703 OS=Oryza sativa subsp. japonica GN=JMJ703 PE=1 SV=1 492 873 2.0E-75
sp|Q8GUI6|JMJ14_ARATH Probable lysine-specific demethylase JMJ14 OS=Arabidopsis thaliana GN=JMJ14 PE=1 SV=1 490 887 9.0E-74
sp|P47156|JHD2_YEAST Histone demethylase JHD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JHD2 PE=1 SV=1 442 778 3.0E-70
sp|F4I6G4|JMJ18_ARATH Lysine-specific demethylase JMJ18 OS=Arabidopsis thaliana GN=JMJ18 PE=2 SV=1 492 873 4.0E-68
sp|O64752|JMJ15_ARATH Lysine-specific demethylase JMJ15 OS=Arabidopsis thaliana GN=JMJ15 PE=2 SV=1 492 887 2.0E-66
sp|Q336N8|JM706_ORYSJ Lysine-specific demethylase JMJ706 OS=Oryza sativa subsp. japonica GN=JMJ706 PE=2 SV=1 539 765 5.0E-46
sp|Q62315|JARD2_MOUSE Protein Jumonji OS=Mus musculus GN=Jarid2 PE=1 SV=1 538 906 2.0E-40
sp|Q92833|JARD2_HUMAN Protein Jumonji OS=Homo sapiens GN=JARID2 PE=1 SV=2 538 906 5.0E-40
sp|Q5N712|JM705_ORYSJ Lysine-specific demethylase JMJ705 OS=Oryza sativa subsp. japonica GN=JMJ705 PE=1 SV=1 501 765 5.0E-40
sp|Q1LVC2|JARD2_DANRE Protein Jumonji OS=Danio rerio GN=jarid2b PE=3 SV=2 487 863 5.0E-40
sp|Q10RP4|SE14_ORYSJ Lysine-specific demethylase SE14 OS=Oryza sativa subsp. japonica GN=SE14 PE=3 SV=2 495 765 7.0E-40
sp|Q5F363|JARD2_CHICK Protein Jumonji OS=Gallus gallus GN=JARID2 PE=2 SV=1 535 906 6.0E-39
sp|Q8L7T6|JMJ19_ARATH Probable inactive lysine-specific demethylase JMJ19 OS=Arabidopsis thaliana GN=JMJ19 PE=2 SV=1 496 765 5.0E-38
sp|Q9STM3|REF6_ARATH Lysine-specific demethylase REF6 OS=Arabidopsis thaliana GN=REF6 PE=1 SV=1 495 770 3.0E-37
sp|Q6IQX0|KD5BB_DANRE Lysine-specific demethylase 5B-B OS=Danio rerio GN=kdm5bb PE=2 SV=2 96 285 4.0E-33
sp|Q6BDA0|ELF6_ARATH Probable lysine-specific demethylase ELF6 OS=Arabidopsis thaliana GN=ELF6 PE=1 SV=1 495 762 4.0E-33
sp|P39956|RPH1_YEAST DNA damage-responsive transcriptional repressor RPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPH1 PE=1 SV=1 503 739 5.0E-33
sp|Q30DN6|KDM5D_CANLF Lysine-specific demethylase 5D OS=Canis lupus familiaris GN=KDM5D PE=2 SV=1 96 253 1.0E-32
sp|Q8VCD7|KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus GN=Kdm4c PE=1 SV=1 497 742 2.0E-32
sp|Q9H3R0|KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens GN=KDM4C PE=1 SV=2 497 739 2.0E-32
sp|P29375|KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens GN=KDM5A PE=1 SV=3 96 253 3.0E-32
sp|P41230|KDM5C_MOUSE Lysine-specific demethylase 5C OS=Mus musculus GN=Kdm5c PE=1 SV=4 96 253 7.0E-32
sp|P41229|KDM5C_HUMAN Lysine-specific demethylase 5C OS=Homo sapiens GN=KDM5C PE=1 SV=2 96 253 8.0E-32
sp|Q38JA7|KDM5C_CANLF Lysine-specific demethylase 5C OS=Canis lupus familiaris GN=KDM5C PE=2 SV=1 96 253 8.0E-32
sp|Q9V6L0|KDM4B_DROME Probable lysine-specific demethylase 4B OS=Drosophila melanogaster GN=Kdm4B PE=3 SV=3 484 743 2.0E-31
sp|B2RXH2|KDM4E_HUMAN Lysine-specific demethylase 4E OS=Homo sapiens GN=KDM4E PE=1 SV=1 558 739 6.0E-31
sp|Q3U2K5|KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus GN=Kdm4d PE=2 SV=2 537 739 7.0E-31
sp|A1A5Q5|KDM4D_RAT Lysine-specific demethylase 4D OS=Rattus norvegicus GN=Kdm4d PE=2 SV=1 537 739 2.0E-30
sp|O75164|KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens GN=KDM4A PE=1 SV=2 471 743 3.0E-30
sp|Q5RD88|KDM4A_PONAB Lysine-specific demethylase 4A OS=Pongo abelii GN=KDM4A PE=2 SV=1 471 743 3.0E-30
sp|Q6B0I6|KDM4D_HUMAN Lysine-specific demethylase 4D OS=Homo sapiens GN=KDM4D PE=1 SV=3 537 739 5.0E-30
sp|Q8BW72|KDM4A_MOUSE Lysine-specific demethylase 4A OS=Mus musculus GN=Kdm4a PE=1 SV=3 497 743 8.0E-30
sp|Q91VY5|KDM4B_MOUSE Lysine-specific demethylase 4B OS=Mus musculus GN=Kdm4b PE=2 SV=1 537 739 2.0E-29
sp|O94953|KDM4B_HUMAN Lysine-specific demethylase 4B OS=Homo sapiens GN=KDM4B PE=1 SV=4 537 739 2.0E-29
sp|Q9V333|KDM4A_DROME Probable lysine-specific demethylase 4A OS=Drosophila melanogaster GN=Kdm4A PE=1 SV=1 502 739 1.0E-27
sp|Q03214|ECM5_YEAST Protein ECM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM5 PE=1 SV=1 58 253 1.0E-26
sp|Q9U297|KDM4_CAEEL Lysine-specific demethylase 4 OS=Caenorhabditis elegans GN=jmjd-2 PE=3 SV=2 587 743 1.0E-26
sp|Q23541|KDM5_CAEEL Lysine-specific demethylase rbr-2 OS=Caenorhabditis elegans GN=rbr-2 PE=1 SV=2 86 224 2.0E-22
sp|Q61T02|KDM5_CAEBR Lysine-specific demethylase rbr-2 OS=Caenorhabditis briggsae GN=rbr-2 PE=3 SV=2 97 224 2.0E-22
sp|Q9US53|JMJ2_SCHPO Jumonji/ARID domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=jmj2 PE=3 SV=1 92 268 9.0E-21
sp|Q03833|GIS1_YEAST Transcriptional activator/repressor GIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS1 PE=1 SV=1 490 753 4.0E-19
sp|A1YVX4|KDM5C_PIG Lysine-specific demethylase 5C OS=Sus scrofa GN=KDM5C PE=2 SV=1 96 253 6.0E-15
sp|Q92833|JARD2_HUMAN Protein Jumonji OS=Homo sapiens GN=JARID2 PE=1 SV=2 94 268 2.0E-13
sp|Q5F363|JARD2_CHICK Protein Jumonji OS=Gallus gallus GN=JARID2 PE=2 SV=1 94 268 2.0E-13
sp|Q03214|ECM5_YEAST Protein ECM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM5 PE=1 SV=1 531 768 3.0E-13
sp|Q62315|JARD2_MOUSE Protein Jumonji OS=Mus musculus GN=Jarid2 PE=1 SV=1 94 268 6.0E-13
sp|Q1LVC2|JARD2_DANRE Protein Jumonji OS=Danio rerio GN=jarid2b PE=3 SV=2 93 268 5.0E-10
sp|A6PWV5|ARI3C_MOUSE AT-rich interactive domain-containing protein 3C OS=Mus musculus GN=Arid3c PE=2 SV=2 168 263 2.0E-09
sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 439 488 2.0E-09
sp|Q3UXZ9|KDM5A_MOUSE Lysine-specific demethylase 5A OS=Mus musculus GN=Kdm5a PE=1 SV=2 1312 1406 4.0E-09
sp|Q63625|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2 439 488 4.0E-09
sp|A6NKF2|ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens GN=ARID3C PE=3 SV=1 168 263 5.0E-09
sp|A2BEA6|ARI3A_DANRE AT-rich interactive domain-containing protein 3A OS=Danio rerio GN=arid3a PE=1 SV=1 168 260 7.0E-09
sp|P29375|KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens GN=KDM5A PE=1 SV=3 1312 1406 1.0E-08
sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 439 486 1.0E-08
sp|Q4H3P5|DRI_CIOIN Protein dead ringer homolog OS=Ciona intestinalis GN=Ci-DRIL1/2 PE=2 SV=1 168 260 4.0E-08
sp|Q6GQD7|ARI3A_XENLA AT-rich interactive domain-containing protein 3A OS=Xenopus laevis GN=arid3a PE=2 SV=1 168 328 4.0E-08
sp|Q5XGD9|ARI3A_XENTR AT-rich interactive domain-containing protein 3A OS=Xenopus tropicalis GN=arid3a PE=2 SV=1 168 280 6.0E-08
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 445 488 6.0E-08
sp|Q8MQH7|DRI_STRPU Protein dead ringer homolog OS=Strongylocentrotus purpuratus GN=dri PE=2 SV=1 168 251 6.0E-08
sp|Q24573|DRI_DROME Protein dead ringer OS=Drosophila melanogaster GN=retn PE=1 SV=2 168 251 7.0E-08
sp|Q53WJ1|JM703_ORYSJ Lysine-specific demethylase JMJ703 OS=Oryza sativa subsp. japonica GN=JMJ703 PE=1 SV=1 56 177 1.0E-07
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 411 487 2.0E-07
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 405 486 2.0E-07
sp|Q8IVW6|ARI3B_HUMAN AT-rich interactive domain-containing protein 3B OS=Homo sapiens GN=ARID3B PE=1 SV=2 168 251 2.0E-07
sp|Q8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens GN=KMT2C PE=1 SV=3 440 487 2.0E-07
sp|Q68CP9|ARID2_HUMAN AT-rich interactive domain-containing protein 2 OS=Homo sapiens GN=ARID2 PE=1 SV=2 163 253 2.0E-07
sp|Q8BRH4|KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus GN=Kmt2c PE=1 SV=2 440 487 2.0E-07
sp|Q62431|ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus GN=Arid3a PE=1 SV=1 168 251 2.0E-07
sp|Q9SGH2|MBD9_ARATH Methyl-CpG-binding domain-containing protein 9 OS=Arabidopsis thaliana GN=MBD9 PE=2 SV=1 442 489 2.0E-07
sp|Q336N8|JM706_ORYSJ Lysine-specific demethylase JMJ706 OS=Oryza sativa subsp. japonica GN=JMJ706 PE=2 SV=1 94 169 3.0E-07
sp|Q9Z1N7|ARI3B_MOUSE AT-rich interactive domain-containing protein 3B OS=Mus musculus GN=Arid3b PE=2 SV=1 168 251 3.0E-07
sp|Q99856|ARI3A_HUMAN AT-rich interactive domain-containing protein 3A OS=Homo sapiens GN=ARID3A PE=1 SV=2 168 251 3.0E-07
sp|O64752|JMJ15_ARATH Lysine-specific demethylase JMJ15 OS=Arabidopsis thaliana GN=JMJ15 PE=2 SV=1 94 137 4.0E-07
sp|Q96BD5|PF21A_HUMAN PHD finger protein 21A OS=Homo sapiens GN=PHF21A PE=1 SV=1 445 486 4.0E-07
sp|Q9HDV4|LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lid2 PE=1 SV=1 90 203 5.0E-07
sp|Q03214|ECM5_YEAST Protein ECM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM5 PE=1 SV=1 1030 1436 5.0E-07
sp|F4I6G4|JMJ18_ARATH Lysine-specific demethylase JMJ18 OS=Arabidopsis thaliana GN=JMJ18 PE=2 SV=1 94 159 1.0E-06
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 442 486 1.0E-06
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 443 486 1.0E-06
sp|Q6ZPK0|PF21A_MOUSE PHD finger protein 21A OS=Mus musculus GN=Phf21a PE=1 SV=2 445 486 1.0E-06
sp|Q8GUI6|JMJ14_ARATH Probable lysine-specific demethylase JMJ14 OS=Arabidopsis thaliana GN=JMJ14 PE=1 SV=1 94 159 2.0E-06
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 442 486 2.0E-06
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 442 486 2.0E-06
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 442 486 2.0E-06
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 442 486 2.0E-06
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 442 486 2.0E-06
sp|B9RU15|ATXR5_RICCO Probable Histone-lysine N-methyltransferase ATXR5 OS=Ricinus communis GN=ATXR5 PE=1 SV=1 442 486 4.0E-06
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 426 486 7.0E-06
sp|Q8IN94|OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster GN=osa PE=1 SV=1 168 251 7.0E-06
sp|Q96T23|RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens GN=RSF1 PE=1 SV=2 442 486 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
AT-rich interaction region

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9370
MVPAQPGRAATAANPNSANASTRSSPAPAAPSGPPSSSSRPKHKVNTNGYHPANSQMPLSAMTSAALDLTSVERR
GQPTAVREPLKKKTRPHGISEAPTYCPTDDDWRDPLEYIKKIAPEASQFGICKIIPPDSWNPDFAIDTEKFHFRT
RKQELNSVEGSTRANLTYLDGLAKFHKQHGNNLHRLPYVDKKPLDLYRLKKAVESRGGFDKVCKLKKWAEIGRDL
GYSGKIMSSLSTSLKNSYQRWLCPYEEYLRLAKPGVHQQLEQEYGGPLTPSPAPTPVRRSNVDTPSSVKADSPAR
QASDALQATFSSLKNEVDRDSPMDDAPPAPTSGPISGGFTAINTNGFTAVNSAPSNANRSTHAESKSFTPDSKRL
DSPTSSAKDTPDAKSSGLAAAAALKRQLSYGSSSDSNKRDSDGDRDDGESNSRRSKRLKKDAVPTKCENCGRGEE
AGSLLVCESCDNAYHGPCLDPPLKRKPEAEWNCPRCLVGDGQFGFEEGGLYSLKQFQQKANDFKQGYFEKKMPFD
HALNCHRPVTEEDVETEFWRLVADLEETVEVEYGADIHCTTHGSGFPTVEKNPSNPYATDPWNLNVLPFHAESLF
RHIKSDVSGMTVPWVYVGMIFSTFCWHNEDHYAYSANYQHFGATKTWYGIPGEDADKFEAAMKEAVPELFETQPD
LLFQLVTLLTPEQLKKAGVRVHALDQRAGQFVITFPQAYHAGFNHGFNFNEAVNFAPCDWEPFGAAGVDRLQIFR
RQPCFSHDELLWTAAEGSAVSGLTIQTAKWLAPALDRVHKREMGQREGFVAKHVESTSHRCLLSGDGEDSCPLTF
KIEDEDVLDEDEQCCSHCKVFAYLSRYKCQRSGKVLCLLHAGSHACCDQTEQQRFAGDEHTLYHRKADDVMTAVC
DRVVEKARTPELWEEKYAKLLDEEATPSLKSLRTLLHEGERIPHELPSLPILKGFVDRCNDWVEEATNYIVRKQQ
NRRKSDKVWQSAARKSIGGGTYQDQKERESRNVSNIYRLLRDAEHIGFDCPEIGQLQERAGAIKEFQINAARALD
NTATIPMETVEELLEEGRSFNVDTPEVDRLSRVLEQMRWNQKARSSRGVFLSLKEVQDLIEEGKRLDIPSYNDHL
KYYCDQMHTGEAWERKARELIDMETIHYPQLEALSNQVQVNALPVSQETLAIVDQILHKQREAHRQIVDIINRCK
HDDFRERPRYTEAVEISKKVDDLNSKPTGTLDLETERKRHEDWMRKGKKLFGKSNAPLHILKSHLEYVLERNMDC
FDVEHDTPRLPGEPVSREASPEQGAGRWEDPRSRQVFCICRKIEAGMMIECELCHEWYHYKCLKIARGKVKEDDK
YTCPICDWRMKIPRDAARPKLEDLMLLSEEIRTLPFQPEEEEILTRIIDNAQTFRDHIARYCNPLLSTEAEVETQ
RFYLRKLEGAEVLLAYETNFFRQELHKWCPVAPEAPPILEVSLSTRKPRPTKLQKMLAEYGVDNPDDLPEHAKGK
ANSLRRKAANAEAAAAAAAAAAAHAAGSGVMMPPSNSSAYGGPAFFARTATHGGAAAAAATHGHPTKASDAADKE
RRKMEAGEVDSMLHPGFLGAGGPQLLVDNSALSLEERLLQGQEDGINLQTEAGKSKALEILGRTEVGRKQAEKIW
GPHVWRPSRRSMSDQDGPMTPGEMDGMMKHDDGKVDQMFKEMTNQDDDEEQKKKEGAANGAVTAESLESERNGLD
ALLDGD*
Coding >Hirsu2|9370
ATGGTGCCGGCCCAGCCTGGCCGAGCCGCAACAGCGGCCAACCCCAACAGCGCCAATGCAAGCACTCGCAGCTCG
CCTGCCCCCGCCGCCCCGTCGGGCCCGCCCTCGTCGTCGTCGAGGCCGAAGCACAAGGTCAACACCAACGGCTAC
CATCCCGCCAACTCCCAGATGCCCCTGAGCGCCATGACCAGCGCCGCCCTCGACCTGACCTCGGTCGAGCGCCGC
GGCCAGCCCACGGCGGTGCGCGAGCCCCTCAAGAAGAAGACGCGCCCCCACGGCATCTCCGAGGCCCCGACCTAC
TGTCCGACCGACGACGACTGGCGGGACCCGCTCGAGTACATCAAGAAGATTGCCCCGGAAGCCTCCCAGTTCGGC
ATATGCAAGATCATCCCCCCCGACTCCTGGAATCCCGACTTCGCCATCGACACCGAGAAGTTTCACTTTCGGACC
CGGAAACAGGAGCTCAACTCCGTCGAAGGAAGCACCCGGGCAAACCTGACCTATCTCGACGGCCTCGCCAAGTTT
CACAAGCAGCACGGCAACAACCTACACCGCCTACCATACGTTGACAAGAAGCCGCTGGACTTGTACCGCCTAAAG
AAGGCGGTCGAGTCTCGCGGCGGCTTCGACAAGGTCTGCAAGCTGAAGAAGTGGGCGGAAATCGGTCGCGACCTG
GGCTACAGCGGCAAGATCATGTCGTCGCTCTCCACCTCTCTCAAGAACTCGTACCAGCGCTGGCTATGCCCCTAC
GAGGAGTACCTCCGCCTGGCCAAGCCCGGCGTCCACCAGCAGCTGGAGCAGGAATACGGAGGTCCCCTCACGCCC
AGCCCGGCGCCGACCCCCGTCCGACGGTCCAACGTCGACACCCCCTCGAGCGTCAAGGCCGACTCGCCCGCCCGG
CAGGCCTCCGACGCCCTGCAGGCCACCTTCAGCAGTCTGAAAAACGAGGTCGATCGGGATAGCCCCATGGACGAT
GCCCCACCCGCGCCCACATCCGGCCCCATATCGGGAGGTTTCACGGCCATCAACACCAATGGTTTCACCGCCGTA
AACTCGGCACCCAGCAACGCCAACAGATCCACCCATGCCGAAAGCAAAAGCTTCACCCCCGACTCGAAGCGGCTC
GACAGTCCCACATCGTCGGCAAAGGACACCCCGGACGCCAAGTCGTCGGGCCTCGCCGCCGCCGCAGCGTTGAAG
CGCCAGCTCAGCTATGGAAGCTCGTCGGACTCGAACAAGAGAGACAGCGACGGCGACCGCGACGACGGCGAAAGC
AATAGTCGCCGCAGCAAGCGGCTGAAGAAGGATGCCGTCCCGACCAAATGCGAAAACTGTGGGAGAGGCGAGGAG
GCGGGCTCTCTGCTCGTATGCGAGTCGTGCGACAACGCATACCACGGCCCATGCCTCGACCCTCCCCTCAAGCGC
AAACCAGAGGCCGAGTGGAACTGCCCGCGCTGCCTGGTCGGCGACGGGCAGTTTGGATTCGAGGAGGGCGGCCTC
TACTCGTTGAAGCAATTTCAGCAAAAGGCCAACGACTTCAAGCAGGGCTACTTCGAGAAGAAGATGCCCTTCGAT
CACGCACTCAACTGCCACCGGCCGGTCACCGAAGAAGACGTCGAGACGGAATTCTGGCGCCTGGTTGCCGACCTG
GAAGAGACGGTCGAGGTCGAGTATGGTGCCGACATACACTGCACCACGCATGGATCTGGATTCCCGACGGTCGAG
AAGAACCCGAGCAACCCCTACGCCACCGATCCGTGGAACCTCAACGTGCTCCCCTTCCATGCCGAGAGCCTGTTC
AGACACATCAAGTCCGACGTCTCGGGCATGACGGTCCCCTGGGTCTACGTCGGCATGATCTTCTCGACGTTTTGC
TGGCACAACGAAGACCACTACGCCTATTCCGCCAACTACCAGCACTTTGGCGCGACGAAGACTTGGTACGGCATC
CCGGGAGAAGATGCCGACAAGTTCGAGGCGGCCATGAAGGAGGCGGTGCCCGAACTCTTCGAAACGCAGCCGGAT
CTGCTGTTTCAGCTCGTCACGCTGCTCACACCCGAGCAGCTCAAGAAGGCCGGGGTGCGGGTCCATGCCCTGGAC
CAGCGCGCCGGCCAGTTCGTCATCACGTTTCCCCAGGCCTACCACGCCGGCTTCAACCATGGCTTCAACTTCAAC
GAGGCCGTCAACTTCGCCCCATGCGACTGGGAGCCCTTTGGGGCCGCCGGCGTGGACAGGCTCCAGATCTTCCGG
CGGCAGCCCTGCTTCTCCCACGACGAGCTGCTCTGGACGGCCGCAGAGGGCAGCGCGGTGTCCGGGCTCACGATC
CAGACGGCCAAGTGGCTTGCGCCGGCGCTGGACCGTGTCCACAAGCGCGAGATGGGACAGCGGGAGGGCTTCGTC
GCCAAACACGTCGAGTCGACCTCTCATCGGTGCCTGCTGTCCGGTGACGGCGAGGACAGCTGCCCTCTCACCTTT
AAGATCGAGGACGAGGACGTCCTGGACGAGGACGAGCAGTGCTGCAGCCACTGCAAGGTCTTTGCCTACCTGTCG
CGCTACAAGTGCCAGCGGTCCGGCAAGGTCTTGTGCCTCCTGCACGCCGGATCCCACGCTTGCTGCGACCAGACC
GAGCAGCAGCGGTTCGCCGGAGACGAGCACACCCTCTACCATCGCAAGGCGGACGACGTCATGACGGCCGTCTGC
GATCGGGTCGTCGAAAAGGCCCGCACGCCAGAGCTTTGGGAAGAGAAGTACGCGAAGCTGCTGGACGAGGAGGCG
ACGCCGTCTCTCAAATCACTGCGGACGCTGCTCCACGAGGGCGAGCGGATTCCCCACGAGCTCCCGTCGCTGCCG
ATCCTGAAGGGCTTCGTCGACAGGTGCAACGACTGGGTCGAGGAGGCGACCAACTACATCGTGCGCAAGCAGCAG
AACCGCCGGAAGAGCGACAAGGTGTGGCAGAGCGCGGCGCGAAAGTCGATAGGCGGCGGGACATACCAGGATCAG
AAGGAGCGCGAATCGCGCAACGTGTCCAACATCTATCGGCTTCTGAGAGATGCCGAGCACATTGGATTTGACTGC
CCCGAGATCGGCCAGCTGCAAGAGCGGGCGGGCGCGATCAAAGAGTTTCAGATAAACGCGGCCCGGGCCCTGGAC
AACACGGCAACGATACCGATGGAGACGGTCGAGGAGCTCCTCGAAGAAGGCCGCAGCTTCAACGTGGACACGCCC
GAGGTGGATCGGCTGTCGAGGGTTCTCGAGCAAATGCGGTGGAACCAGAAGGCTCGCTCGAGCCGCGGCGTCTTC
CTCTCTCTCAAGGAGGTTCAGGATCTCATCGAGGAAGGCAAGCGGCTGGACATACCGAGCTACAACGACCACCTC
AAGTACTACTGCGACCAGATGCACACGGGCGAGGCCTGGGAGAGGAAGGCGAGAGAGCTGATCGACATGGAGACG
ATCCACTACCCGCAGCTCGAGGCGCTGTCGAACCAGGTGCAGGTCAACGCGCTGCCGGTCTCGCAGGAGACGCTC
GCCATAGTCGACCAGATCCTGCACAAGCAGCGGGAGGCGCATCGGCAAATAGTGGACATCATCAACCGCTGCAAG
CACGACGACTTCCGCGAGAGGCCCAGGTACACGGAGGCCGTCGAAATCTCCAAGAAGGTCGACGATCTCAACTCG
AAGCCGACCGGCACGCTGGACCTCGAGACGGAGAGGAAGCGGCACGAAGACTGGATGCGCAAAGGCAAGAAGCTG
TTTGGGAAGTCGAACGCGCCCCTCCACATTCTTAAGAGCCACCTCGAGTATGTGTTGGAGCGCAACATGGACTGC
TTCGACGTGGAGCACGACACGCCACGCCTGCCCGGCGAGCCGGTGTCGCGAGAAGCCAGCCCCGAGCAGGGCGCA
GGCCGGTGGGAAGATCCCCGCTCCAGGCAGGTCTTTTGCATCTGCAGGAAGATTGAGGCCGGCATGATGATTGAA
TGCGAGCTCTGCCACGAATGGTATCACTACAAGTGCCTCAAGATTGCTCGCGGCAAGGTCAAGGAGGACGACAAG
TACACGTGCCCGATATGCGACTGGCGCATGAAGATTCCTCGCGACGCGGCACGGCCCAAGCTCGAGGACCTGATG
CTGCTGTCGGAGGAGATCCGAACGTTGCCCTTCCAGCCGGAGGAGGAGGAGATCCTGACGCGCATCATCGACAAC
GCGCAGACTTTCCGGGACCACATCGCCCGATACTGCAACCCCCTGCTGTCGACGGAAGCCGAGGTGGAGACGCAG
CGGTTCTACCTGCGCAAGCTCGAGGGCGCCGAGGTGCTGCTAGCGTACGAGACCAACTTCTTCCGCCAGGAGCTC
CACAAGTGGTGTCCGGTGGCGCCGGAAGCGCCGCCGATCCTGGAGGTGTCGCTGAGCACGCGCAAGCCGCGGCCG
ACGAAGCTGCAGAAGATGCTGGCGGAGTACGGGGTGGACAACCCGGACGACTTGCCGGAACACGCCAAGGGCAAG
GCCAACAGCCTGCGGCGCAAGGCGGCGAACGCGGAGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGCACGCG
GCGGGGTCGGGGGTGATGATGCCGCCGTCGAACAGCTCGGCGTACGGCGGGCCGGCCTTCTTCGCGCGGACGGCG
ACGCACGGGGGCGCGGCGGCGGCGGCTGCGACGCACGGGCACCCTACCAAGGCGTCGGACGCGGCGGACAAGGAG
CGGCGCAAGATGGAGGCGGGCGAGGTGGACAGCATGCTGCACCCCGGCTTCCTGGGCGCGGGCGGGCCGCAGCTG
CTGGTGGACAACTCGGCCCTGTCGCTGGAGGAGCGGCTGCTGCAGGGCCAGGAGGACGGCATCAACCTGCAGACG
GAGGCCGGGAAGAGTAAGGCTCTGGAGATTCTCGGCCGAACGGAGGTGGGCCGCAAGCAGGCGGAGAAGATCTGG
GGGCCGCACGTGTGGCGGCCGAGCCGGCGGTCGATGAGCGACCAGGACGGGCCGATGACGCCGGGCGAGATGGAC
GGGATGATGAAGCACGACGACGGCAAGGTGGACCAGATGTTCAAGGAGATGACGAACCAGGACGACGACGAGGAG
CAGAAGAAGAAGGAGGGGGCGGCGAACGGGGCGGTGACGGCGGAGTCTCTGGAGAGCGAGAGGAACGGGCTGGAC
GCTCTGCTAGACGGGGATTAA
Transcript >Hirsu2|9370
ATGGTGCCGGCCCAGCCTGGCCGAGCCGCAACAGCGGCCAACCCCAACAGCGCCAATGCAAGCACTCGCAGCTCG
CCTGCCCCCGCCGCCCCGTCGGGCCCGCCCTCGTCGTCGTCGAGGCCGAAGCACAAGGTCAACACCAACGGCTAC
CATCCCGCCAACTCCCAGATGCCCCTGAGCGCCATGACCAGCGCCGCCCTCGACCTGACCTCGGTCGAGCGCCGC
GGCCAGCCCACGGCGGTGCGCGAGCCCCTCAAGAAGAAGACGCGCCCCCACGGCATCTCCGAGGCCCCGACCTAC
TGTCCGACCGACGACGACTGGCGGGACCCGCTCGAGTACATCAAGAAGATTGCCCCGGAAGCCTCCCAGTTCGGC
ATATGCAAGATCATCCCCCCCGACTCCTGGAATCCCGACTTCGCCATCGACACCGAGAAGTTTCACTTTCGGACC
CGGAAACAGGAGCTCAACTCCGTCGAAGGAAGCACCCGGGCAAACCTGACCTATCTCGACGGCCTCGCCAAGTTT
CACAAGCAGCACGGCAACAACCTACACCGCCTACCATACGTTGACAAGAAGCCGCTGGACTTGTACCGCCTAAAG
AAGGCGGTCGAGTCTCGCGGCGGCTTCGACAAGGTCTGCAAGCTGAAGAAGTGGGCGGAAATCGGTCGCGACCTG
GGCTACAGCGGCAAGATCATGTCGTCGCTCTCCACCTCTCTCAAGAACTCGTACCAGCGCTGGCTATGCCCCTAC
GAGGAGTACCTCCGCCTGGCCAAGCCCGGCGTCCACCAGCAGCTGGAGCAGGAATACGGAGGTCCCCTCACGCCC
AGCCCGGCGCCGACCCCCGTCCGACGGTCCAACGTCGACACCCCCTCGAGCGTCAAGGCCGACTCGCCCGCCCGG
CAGGCCTCCGACGCCCTGCAGGCCACCTTCAGCAGTCTGAAAAACGAGGTCGATCGGGATAGCCCCATGGACGAT
GCCCCACCCGCGCCCACATCCGGCCCCATATCGGGAGGTTTCACGGCCATCAACACCAATGGTTTCACCGCCGTA
AACTCGGCACCCAGCAACGCCAACAGATCCACCCATGCCGAAAGCAAAAGCTTCACCCCCGACTCGAAGCGGCTC
GACAGTCCCACATCGTCGGCAAAGGACACCCCGGACGCCAAGTCGTCGGGCCTCGCCGCCGCCGCAGCGTTGAAG
CGCCAGCTCAGCTATGGAAGCTCGTCGGACTCGAACAAGAGAGACAGCGACGGCGACCGCGACGACGGCGAAAGC
AATAGTCGCCGCAGCAAGCGGCTGAAGAAGGATGCCGTCCCGACCAAATGCGAAAACTGTGGGAGAGGCGAGGAG
GCGGGCTCTCTGCTCGTATGCGAGTCGTGCGACAACGCATACCACGGCCCATGCCTCGACCCTCCCCTCAAGCGC
AAACCAGAGGCCGAGTGGAACTGCCCGCGCTGCCTGGTCGGCGACGGGCAGTTTGGATTCGAGGAGGGCGGCCTC
TACTCGTTGAAGCAATTTCAGCAAAAGGCCAACGACTTCAAGCAGGGCTACTTCGAGAAGAAGATGCCCTTCGAT
CACGCACTCAACTGCCACCGGCCGGTCACCGAAGAAGACGTCGAGACGGAATTCTGGCGCCTGGTTGCCGACCTG
GAAGAGACGGTCGAGGTCGAGTATGGTGCCGACATACACTGCACCACGCATGGATCTGGATTCCCGACGGTCGAG
AAGAACCCGAGCAACCCCTACGCCACCGATCCGTGGAACCTCAACGTGCTCCCCTTCCATGCCGAGAGCCTGTTC
AGACACATCAAGTCCGACGTCTCGGGCATGACGGTCCCCTGGGTCTACGTCGGCATGATCTTCTCGACGTTTTGC
TGGCACAACGAAGACCACTACGCCTATTCCGCCAACTACCAGCACTTTGGCGCGACGAAGACTTGGTACGGCATC
CCGGGAGAAGATGCCGACAAGTTCGAGGCGGCCATGAAGGAGGCGGTGCCCGAACTCTTCGAAACGCAGCCGGAT
CTGCTGTTTCAGCTCGTCACGCTGCTCACACCCGAGCAGCTCAAGAAGGCCGGGGTGCGGGTCCATGCCCTGGAC
CAGCGCGCCGGCCAGTTCGTCATCACGTTTCCCCAGGCCTACCACGCCGGCTTCAACCATGGCTTCAACTTCAAC
GAGGCCGTCAACTTCGCCCCATGCGACTGGGAGCCCTTTGGGGCCGCCGGCGTGGACAGGCTCCAGATCTTCCGG
CGGCAGCCCTGCTTCTCCCACGACGAGCTGCTCTGGACGGCCGCAGAGGGCAGCGCGGTGTCCGGGCTCACGATC
CAGACGGCCAAGTGGCTTGCGCCGGCGCTGGACCGTGTCCACAAGCGCGAGATGGGACAGCGGGAGGGCTTCGTC
GCCAAACACGTCGAGTCGACCTCTCATCGGTGCCTGCTGTCCGGTGACGGCGAGGACAGCTGCCCTCTCACCTTT
AAGATCGAGGACGAGGACGTCCTGGACGAGGACGAGCAGTGCTGCAGCCACTGCAAGGTCTTTGCCTACCTGTCG
CGCTACAAGTGCCAGCGGTCCGGCAAGGTCTTGTGCCTCCTGCACGCCGGATCCCACGCTTGCTGCGACCAGACC
GAGCAGCAGCGGTTCGCCGGAGACGAGCACACCCTCTACCATCGCAAGGCGGACGACGTCATGACGGCCGTCTGC
GATCGGGTCGTCGAAAAGGCCCGCACGCCAGAGCTTTGGGAAGAGAAGTACGCGAAGCTGCTGGACGAGGAGGCG
ACGCCGTCTCTCAAATCACTGCGGACGCTGCTCCACGAGGGCGAGCGGATTCCCCACGAGCTCCCGTCGCTGCCG
ATCCTGAAGGGCTTCGTCGACAGGTGCAACGACTGGGTCGAGGAGGCGACCAACTACATCGTGCGCAAGCAGCAG
AACCGCCGGAAGAGCGACAAGGTGTGGCAGAGCGCGGCGCGAAAGTCGATAGGCGGCGGGACATACCAGGATCAG
AAGGAGCGCGAATCGCGCAACGTGTCCAACATCTATCGGCTTCTGAGAGATGCCGAGCACATTGGATTTGACTGC
CCCGAGATCGGCCAGCTGCAAGAGCGGGCGGGCGCGATCAAAGAGTTTCAGATAAACGCGGCCCGGGCCCTGGAC
AACACGGCAACGATACCGATGGAGACGGTCGAGGAGCTCCTCGAAGAAGGCCGCAGCTTCAACGTGGACACGCCC
GAGGTGGATCGGCTGTCGAGGGTTCTCGAGCAAATGCGGTGGAACCAGAAGGCTCGCTCGAGCCGCGGCGTCTTC
CTCTCTCTCAAGGAGGTTCAGGATCTCATCGAGGAAGGCAAGCGGCTGGACATACCGAGCTACAACGACCACCTC
AAGTACTACTGCGACCAGATGCACACGGGCGAGGCCTGGGAGAGGAAGGCGAGAGAGCTGATCGACATGGAGACG
ATCCACTACCCGCAGCTCGAGGCGCTGTCGAACCAGGTGCAGGTCAACGCGCTGCCGGTCTCGCAGGAGACGCTC
GCCATAGTCGACCAGATCCTGCACAAGCAGCGGGAGGCGCATCGGCAAATAGTGGACATCATCAACCGCTGCAAG
CACGACGACTTCCGCGAGAGGCCCAGGTACACGGAGGCCGTCGAAATCTCCAAGAAGGTCGACGATCTCAACTCG
AAGCCGACCGGCACGCTGGACCTCGAGACGGAGAGGAAGCGGCACGAAGACTGGATGCGCAAAGGCAAGAAGCTG
TTTGGGAAGTCGAACGCGCCCCTCCACATTCTTAAGAGCCACCTCGAGTATGTGTTGGAGCGCAACATGGACTGC
TTCGACGTGGAGCACGACACGCCACGCCTGCCCGGCGAGCCGGTGTCGCGAGAAGCCAGCCCCGAGCAGGGCGCA
GGCCGGTGGGAAGATCCCCGCTCCAGGCAGGTCTTTTGCATCTGCAGGAAGATTGAGGCCGGCATGATGATTGAA
TGCGAGCTCTGCCACGAATGGTATCACTACAAGTGCCTCAAGATTGCTCGCGGCAAGGTCAAGGAGGACGACAAG
TACACGTGCCCGATATGCGACTGGCGCATGAAGATTCCTCGCGACGCGGCACGGCCCAAGCTCGAGGACCTGATG
CTGCTGTCGGAGGAGATCCGAACGTTGCCCTTCCAGCCGGAGGAGGAGGAGATCCTGACGCGCATCATCGACAAC
GCGCAGACTTTCCGGGACCACATCGCCCGATACTGCAACCCCCTGCTGTCGACGGAAGCCGAGGTGGAGACGCAG
CGGTTCTACCTGCGCAAGCTCGAGGGCGCCGAGGTGCTGCTAGCGTACGAGACCAACTTCTTCCGCCAGGAGCTC
CACAAGTGGTGTCCGGTGGCGCCGGAAGCGCCGCCGATCCTGGAGGTGTCGCTGAGCACGCGCAAGCCGCGGCCG
ACGAAGCTGCAGAAGATGCTGGCGGAGTACGGGGTGGACAACCCGGACGACTTGCCGGAACACGCCAAGGGCAAG
GCCAACAGCCTGCGGCGCAAGGCGGCGAACGCGGAGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGCACGCG
GCGGGGTCGGGGGTGATGATGCCGCCGTCGAACAGCTCGGCGTACGGCGGGCCGGCCTTCTTCGCGCGGACGGCG
ACGCACGGGGGCGCGGCGGCGGCGGCTGCGACGCACGGGCACCCTACCAAGGCGTCGGACGCGGCGGACAAGGAG
CGGCGCAAGATGGAGGCGGGCGAGGTGGACAGCATGCTGCACCCCGGCTTCCTGGGCGCGGGCGGGCCGCAGCTG
CTGGTGGACAACTCGGCCCTGTCGCTGGAGGAGCGGCTGCTGCAGGGCCAGGAGGACGGCATCAACCTGCAGACG
GAGGCCGGGAAGAGTAAGGCTCTGGAGATTCTCGGCCGAACGGAGGTGGGCCGCAAGCAGGCGGAGAAGATCTGG
GGGCCGCACGTGTGGCGGCCGAGCCGGCGGTCGATGAGCGACCAGGACGGGCCGATGACGCCGGGCGAGATGGAC
GGGATGATGAAGCACGACGACGGCAAGGTGGACCAGATGTTCAAGGAGATGACGAACCAGGACGACGACGAGGAG
CAGAAGAAGAAGGAGGGGGCGGCGAACGGGGCGGTGACGGCGGAGTCTCTGGAGAGCGAGAGGAACGGGCTGGAC
GCTCTGCTAGACGGGGATTAA
Gene >Hirsu2|9370
ATGGTGCCGGCCCAGCCTGGCCGAGCCGCAACAGCGGCCAACCCCAACAGCGCCAATGCAAGCACTCGCAGCTCG
CCTGCCCCCGCCGCCCCGTCGGGCCCGCCCTCGTCGTCGTCGAGGCCGAAGCACAAGGTCAACACCAACGGCTAC
CATCCCGCCAACTCCCAGATGCCCCTGAGCGCCATGACCAGCGCCGCCCTCGACCTGACCTCGGTCGAGCGCCGC
GGCCAGCCCACGGCGGTGCGCGAGCCCCTCAAGAAGAAGACGCGCCCCCACGGCATCTCCGAGGCCCCGACCTAC
TGTCCGACCGACGACGACTGGCGGGACCCGCTCGAGTACATCAAGAAGATTGCCCCGGAAGCCTCCCAGTTCGGC
ATATGCAAGATCATCCCCCCCGACTCCTGGAATCCCGACTTCGCCATCGACACCGAGGTACGTTTCCGCCTCGCT
TGCGCCTGCCTCTGTCGTCTGAGCCGCCGTGAGCTGACGGGCCGCCCAACAGAAGTTTCACTTTCGGACCCGGAA
ACAGGAGCTCAACTCCGTCGAAGGAAGTGAGTGCCTCTCCCCGTCCCCTCCCCCGACGCAGCCGAGCTCCCCGTT
TCTTCTTGCTGACCGCCCGAGCCGCAGGCACCCGGGCAAACCTGACCTATCTCGACGGCCTCGCCAAGTTTCACA
AGCAGCACGGCAACAACCTACACCGCCTACCATACGTTGACAAGAAGCCGCTGGACTTGTACCGCCTAAAGAAGG
CGGTCGAGTCTCGCGGCGGCTTCGACAAGGTCTGCAAGCTGAAGAAGTGGGCGGAAATCGGTCGCGACCTGGGCT
ACAGCGGCAAGATCATGTCGTCGCTCTCCACCTCTCTCAAGAACTCGTACCAGCGCTGGCTATGCCCCTACGAGG
AGTACCTCCGCCTGGCCAAGCCCGGCGTCCACCAGCAGCTGGAGCAGGAATACGGAGGTCCCCTCACGCCCAGCC
CGGCGCCGACCCCCGTCCGACGGTCCAACGTCGACACCCCCTCGAGCGTCAAGGCCGACTCGCCCGCCCGGCAGG
CCTCCGACGCCCTGCAGGCCACCTTCAGCAGTCTGAAAAACGAGGTCGATCGGGATAGCCCCATGGACGATGCCC
CACCCGCGCCCACATCCGGCCCCATATCGGGAGGTTTCACGGCCATCAACACCAATGGTTTCACCGCCGTAAACT
CGGCACCCAGCAACGCCAACAGATCCACCCATGCCGAAAGCAAAAGCTTCACCCCCGACTCGAAGCGGCTCGACA
GTCCCACATCGTCGGCAAAGGACACCCCGGACGCCAAGTCGTCGGGCCTCGCCGCCGCCGCAGCGTTGAAGCGCC
AGCTCAGCTATGGAAGCTCGTCGGACTCGAACAAGAGAGACAGCGACGGCGACCGCGACGACGGCGAAAGCAATA
GTCGCCGCAGCAAGCGGCTGAAGAAGGGCAAGTAGCTGCCGCCACCTCGCTCACCTCGTTTGCCCCTCACCATCT
CTAACCCGAACGCTCCTTAGATGCCGTCCCGACCGTCGCCGGCTCTCATATGACTCCCTTTCGCCCCTCGGTCCC
CCGCATTCCGCGCGAGGAAGTCGCAGGAGGCGGCGAGGCAAGTTTTCCGTTTTTTGTTTTTTTTTTCTTTCGTTT
CTCCCCCCCCCCCCCCTTTTGCCCCTCCAGTACGACTGGGCAGGCCGAGGAGGAGAACCTGGTCGCTGACGACGC
GCAGAAATGCGAAAACTGTGGGAGAGGCGAGGAGGCGGGCTCTCTGCTCGTATGCGAGTCGTGCGACAACGCATA
CCACGGCCCATGCCTCGACCCTCCCCTCAAGCGCAAACCAGAGGCCGAGTGGAACTGCCCGCGCTGCCTGGTCGG
CGACGGGCAGTTTGGATTCGAGGAGGGCGGCCTCTACTCGTTGAAGCAATTTCAGCAAAAGGCCAACGACTTCAA
GCAGGGCTACTTCGAGAAGAAGATGCCCTTCGATCACGCACTCAACTGCCACCGGCCGGTCACCGAAGAAGACGT
CGAGACGGAATTCTGGCGCCTGGTTGCCGACCTGGAAGAGACGGTCGAGGTCGAGTATGGTGCCGACATACACTG
CACCACGCATGGATCTGGATTCCCGACGGTCGAGAAGAACCCGAGCAACCCCTACGCCACCGATCCGTGGAACCT
CAACGTGCTCCCCTTCCATGCCGAGAGCCTGTTCAGACACATCAAGTCCGACGTCTCGGGCATGACGGTCCCCTG
GGTCTACGTCGGCATGATCTTCTCGACGTTTTGCTGGCACAACGAAGACCACTACGCCTATTCCGCCAACTACCA
GCACTTTGGCGCGACGAAGACTTGGTACGGCATCCCGGGAGAAGATGCCGACAAGTTCGAGGCGGCCATGAAGGA
GGCGGTGCCCGAACTCTTCGAAACGCAGCCGGATCTGCTGTTTCAGCTCGTCACGCTGCTCACACCCGAGCAGCT
CAAGAAGGCCGGGGTGCGGGTCCATGCCCTGGACCAGCGCGCCGGCCAGTTCGTCATCACGTTTCCCCAGGCCTA
CCACGCCGGCTTCAACCATGGCTTCAACTTCAACGAGGCCGTCAACTTCGCCCCATGCGACTGGGAGCCCTTTGG
GGCCGCCGGCGTGGACAGGCTCCAGATCTTCCGGCGGCAGCCCTGCTTCTCCCACGACGAGCTGCTCTGGACGGC
CGCAGAGGGCAGCGCGGTGTCCGGGCTCACGATCCAGACGGCCAAGTGGCTTGCGCCGGCGCTGGACCGTGTCCA
CAAGCGCGAGATGGGACAGCGGGAGGGCTTCGTCGCCAAACACGTCGAGTCGACCTCTCATCGGTGCCTGCTGTC
CGGTGACGGCGAGGACAGCTGCCCTCTCACCTTTAAGATCGAGGACGAGGACGTCCTGGACGAGGACGAGCAGTG
CTGCAGCCACTGCAAGGTCTTTGCCTACCTGTCGCGCTACAAGTGCCAGCGGTCCGGCAAGGTCTTGTGCCTCCT
GCACGCCGGATCCCACGCTTGCTGCGACCAGACCGAGCAGCAGCGGTTCGCCGGAGACGAGCACACCCTCTACCA
TCGCAAGGCGGACGACGTCATGACGGCCGTCTGCGATCGGGTCGTCGAAAAGGCCCGCACGCCAGAGCTTTGGGA
AGAGAAGTACGCGAAGCTGCTGGACGAGGAGGCGACGCCGTCTCTCAAATCACTGCGGACGCTGCTCCACGAGGG
CGAGCGGATTCCCCACGAGCTCCCGTCGCTGCCGATCCTGAAGGGCTTCGTCGACAGGTGCAACGACTGGGTCGA
GGAGGCGACCAACTACATCGTGCGCAAGCAGCAGAACCGCCGGAAGAGCGACAAGGTGTGGCAGAGCGCGGCGCG
AAAGTCGATAGGCGGCGGGACATACCAGGATCAGAAGGAGCGCGAATCGCGCAACGTGTCCAACATCTATCGGCT
TCTGAGAGATGCCGAGCACATTGGATTTGACTGCCCCGAGATCGGCCAGCTGCAAGAGCGGGCGGGCGCGATCAA
AGAGTTTCAGATAAACGCGGCCCGGGCCCTGGACAACACGGCAACGATACCGATGGAGACGGTCGAGGAGCTCCT
CGAAGAAGGCCGCAGCTTCAACGTGGACACGCCCGAGGTGGATCGGCTGTCGAGGGTTCTCGAGCAAATGCGGTG
GAACCAGAAGGCTCGCTCGAGCCGCGGCGTCTTCCTCTCTCTCAAGGAGGTTCAGGATCTCATCGAGGAAGGCAA
GCGGCTGGACATACCGAGCTACAACGACCACCTCAAGTACTACTGCGACCAGATGCACACGGGCGAGGCCTGGGA
GAGGAAGGCGAGAGAGCTGATCGACATGGAGACGATCCACTACCCGCAGCTCGAGGCGCTGTCGAACCAGGTGCA
GGTCAACGCGCTGCCGGTCTCGCAGGAGACGCTCGCCATAGTCGACCAGATCCTGCACAAGCAGCGGGAGGCGCA
TCGGCAAATAGTGGACATCATCAACCGCTGCAAGCACGACGACTTCCGCGAGAGGCCCAGGTACACGGAGGCCGT
CGAAATCTCCAAGAAGGTCGACGATCTCAACTCGAAGCCGACCGGCACGCTGGACCTCGAGACGGAGAGGAAGCG
GCACGAAGACTGGATGCGCAAAGGCAAGAAGCTGTTTGGGAAGTCGAACGCGCCCCTCCACATTCTTAAGAGCCA
CCTCGAGTATGTGTTGGAGCGCAACATGGACTGCTTCGACGTGGAGCACGACACGCCACGCCTGCCCGGCGAGCC
GGTGTCGCGAGAAGCCAGCCCCGAGCAGGGCGCAGGCCGGTGGGAAGATCCCCGCTCCAGGCAGGTCTTTTGCAT
CTGCAGGAAGATTGAGGCCGGCATGATGATTGAATGCGAGCTCTGCCACGAATGGTAAGTCGGACGGGCAATCTC
GCCTTGACATGATACGATGGGACTAACAAGGAGCGCCCTCCGCGTAGGTATCACTACAAGTGCCTCAAGATTGCT
CGCGGCAAGGTCAAGGAGGACGACAAGTACACGTGCCCGATATGCGACTGGCGCATGAAGATTCCTCGCGACGCG
GCACGGCCCAAGCTCGAGGACCTGATGCTGCTGTCGGAGGAGATCCGAACGTTGCCCTTCCAGCCGGAGGAGGAG
GAGATCCTGACGCGCATCATCGACAACGCGCAGACTTTCCGGGACCACATCGCCCGATACTGCAACCCCCTGCTG
TCGACGGAAGCCGAGGTGGAGACGCAGCGGTTCTACCTGCGCAAGCTCGAGGGCGCCGAGGTGCTGCTAGCGTAC
GAGACCAACTTCTTCCGCCAGGAGCTCCACAAGTGGTGTCCGGTGGCGCCGGAAGCGCCGCCGATCCTGGAGGTG
TCGCTGAGCACGCGCAAGCCGCGGCCGACGAAGCTGCAGAAGATGCTGGCGGAGTACGGGGTGGACAACCCGGAC
GACTTGCCGGAACACGCCAAGGGCAAGGCCAACAGCCTGCGGCGCAAGGCGGCGAACGCGGAGGCGGCGGCGGCG
GCGGCGGCGGCGGCGGCGGCGCACGCGGCGGGGTCGGGGGTGATGATGCCGCCGTCGAACAGCTCGGCGTACGGC
GGGCCGGCCTTCTTCGCGCGGACGGCGACGCACGGGGGCGCGGCGGCGGCGGCTGCGACGCACGGGCACCCTACC
AAGGCGTCGGACGCGGCGGACAAGGAGCGGCGCAAGATGGAGGCGGGCGAGGTGGACAGCATGCTGCACCCCGGC
TTCCTGGGCGCGGGCGGGCCGCAGCTGCTGGTGGACAACTCGGCCCTGTCGCTGGAGGAGCGGCTGCTGCAGGGC
CAGGAGGACGGCATCAACCTGCAGACGGAGGCCGGGAAGAGTAAGGCTCTGGAGATTCTCGGCCGAACGGAGGTG
GGCCGCAAGCAGGCGGAGAAGATCTGGGGGCCGCACGTGTGGCGGCCGAGCCGGCGGTCGATGAGCGACCAGGAC
GGGCCGATGACGCCGGGCGAGATGGACGGGATGATGAAGCACGACGACGGCAAGGTGGACCAGATGTTCAAGGAG
ATGACGAACCAGGACGACGACGAGGAGCAGAAGAAGAAGGAGGGGGCGGCGAACGGGGCGGTGACGGCGGAGTCT
CTGGAGAGCGAGAGGAACGGGCTGGACGCTCTGCTAGACGGGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail