Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9369
Gene name
LocationContig_677:2213..3857
Strand+
Gene length (bp)1644
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.7E-21 73 259
PF00083 Sugar_tr Sugar (and other) transporter 4.0E-05 325 440
PF07690 MFS_1 Major Facilitator Superfamily 1.6E-26 83 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEN1 PE=1 SV=1 56 485 1.0E-66
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 77 508 1.0E-18
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 77 438 7.0E-13
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 77 489 9.0E-13
sp|B1LGI9|NANT_ECOSM Putative sialic acid transporter OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nanT PE=3 SV=1 77 438 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEN1 PE=1 SV=1 56 485 1.0E-66
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 77 508 1.0E-18
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 77 438 7.0E-13
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 77 489 9.0E-13
sp|B1LGI9|NANT_ECOSM Putative sialic acid transporter OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|B6I1U2|NANT_ECOSE Putative sialic acid transporter OS=Escherichia coli (strain SE11) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|B7NKT5|NANT_ECO7I Putative sialic acid transporter OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|B7UJV7|NANT_ECO27 Putative sialic acid transporter OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|A7ZSB7|NANT_ECO24 Putative sialic acid transporter OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|P41036|NANT_ECOLI Putative sialic acid transporter OS=Escherichia coli (strain K12) GN=nanT PE=1 SV=2 77 438 2.0E-12
sp|B1XHJ7|NANT_ECODH Putative sialic acid transporter OS=Escherichia coli (strain K12 / DH10B) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|C4ZSW2|NANT_ECOBW Putative sialic acid transporter OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|P59699|NANT_SHIFL Putative sialic acid transporter OS=Shigella flexneri GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|Q0T066|NANT_SHIF8 Putative sialic acid transporter OS=Shigella flexneri serotype 5b (strain 8401) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|B2U1W0|NANT_SHIB3 Putative sialic acid transporter OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|B1IQQ5|NANT_ECOLC Putative sialic acid transporter OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|B7M0T6|NANT_ECO8A Putative sialic acid transporter OS=Escherichia coli O8 (strain IAI1) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|B7LHS8|NANT_ECO55 Putative sialic acid transporter OS=Escherichia coli (strain 55989 / EAEC) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|B5YSV1|NANT_ECO5E Putative sialic acid transporter OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|Q8X9G8|NANT_ECO57 Putative sialic acid transporter OS=Escherichia coli O157:H7 GN=nanT PE=3 SV=2 77 438 2.0E-12
sp|Q0TCP2|NANT_ECOL5 Putative sialic acid transporter OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nanT PE=3 SV=1 77 438 2.0E-12
sp|Q8FD59|NANT1_ECOL6 Putative sialic acid transporter 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT1 PE=3 SV=2 77 438 3.0E-12
sp|B7MBY6|NANT_ECO45 Putative sialic acid transporter OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nanT PE=3 SV=1 77 438 4.0E-12
sp|A8AQB4|NANT_CITK8 Putative sialic acid transporter OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nanT PE=3 SV=1 77 489 4.0E-12
sp|B7LRJ2|NANT_ESCF3 Putative sialic acid transporter OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nanT PE=3 SV=1 77 438 7.0E-12
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 56 260 2.0E-11
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 56 260 2.0E-11
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 56 260 2.0E-11
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 56 260 2.0E-11
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 56 260 2.0E-11
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 56 423 3.0E-11
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 56 260 4.0E-11
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 56 260 4.0E-11
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 77 438 6.0E-11
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 77 438 8.0E-11
sp|B5F7J8|NANT_SALA4 Putative sialic acid transporter OS=Salmonella agona (strain SL483) GN=nanT PE=3 SV=1 77 438 8.0E-11
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 77 438 8.0E-11
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 77 438 8.0E-11
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 77 438 9.0E-11
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 77 438 9.0E-11
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 77 438 9.0E-11
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 77 438 9.0E-11
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 77 438 9.0E-11
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 77 438 9.0E-11
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 77 438 9.0E-11
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 62 261 2.0E-09
sp|Q8FDU9|NANT2_ECOL6 Putative sialic acid transporter 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT2 PE=3 SV=1 54 492 2.0E-09
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 77 211 9.0E-08
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 77 211 1.0E-07
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 77 211 1.0E-07
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 73 438 4.0E-07
sp|P39352|YJHB_ECOLI Putative metabolite transport protein YjhB OS=Escherichia coli (strain K12) GN=yjhB PE=1 SV=2 56 421 4.0E-07
sp|P0C0L7|PROP_ECOLI Proline/betaine transporter OS=Escherichia coli (strain K12) GN=proP PE=1 SV=1 109 412 5.0E-07
sp|P0C0L8|PROP_ECO57 Proline/betaine transporter OS=Escherichia coli O157:H7 GN=proP PE=3 SV=1 109 412 5.0E-07
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 64 206 8.0E-07
sp|P94131|MUCK_ACIAD Cis,cis-muconate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mucK PE=3 SV=1 82 452 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 106 128 22
3 161 183 22
4 198 220 22
5 227 246 19
6 283 302 19
7 323 345 22
8 355 372 17
9 379 401 22
10 451 473 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9369
MASEQQNEPADDLAKGILPTARQSLRDLFIWRQRVVVSNAEGETRCEWQRPAPLQNPARLLARLSARDWLFFLVG
LAAWTADAFDFHALSIQTVKLAGYYGRSKTDITAAITLTLLLRSVGAAGFGLAGDRWGRKWPMVANMLVLGALQV
ATIYSLTFRQFLAVRALFGLFMGGVYGNAIAMALEQCPVAARGLMSGVLQQGYSLGYVLAACANLGVGGGADSWK
TVFWIAAGISIGVGLVRVLFPESPQFLEARRRRRERGGAGAEAASAGAFWRETRHMLAREWRMCVYCVVLMTWFN
YYSHTSQDSYTTFMLTQKRLGNAGASRASILMKVGACVGGTIVGYLSQFVGRRRAIVAAALASAALIPAWILPES
EAGLSAAGFFLQFCVQGAWGVIPIHLNELSPVAFRSTFPGLTYQLGNMISSPSAQIVNAIAERTFVRLGDGSRAE
AYGPVMGVATAIIALGIVLTTALGPERRGRSFQLPDAADESDDAKLAADDHLPRHQPSLPDEEKAHVEVREAK*
Coding >Hirsu2|9369
ATGGCGTCGGAGCAGCAAAACGAGCCAGCCGACGACCTGGCCAAGGGCATCCTGCCAACGGCGCGGCAGTCGCTG
CGCGACCTGTTCATCTGGCGGCAGCGCGTCGTCGTGTCCAACGCCGAGGGCGAGACGCGGTGCGAGTGGCAGCGG
CCGGCGCCGCTGCAGAACCCGGCCCGGCTGCTGGCCCGGCTCTCCGCCCGCGACTGGCTCTTCTTCCTGGTCGGG
CTGGCGGCCTGGACGGCCGACGCCTTCGACTTCCACGCGCTGTCGATCCAGACGGTCAAGCTGGCCGGCTACTAC
GGCCGCAGCAAGACGGACATCACGGCTGCCATCACGCTGACGCTGCTCCTGCGCTCCGTCGGCGCCGCCGGCTTC
GGCCTCGCCGGCGACCGCTGGGGCCGCAAGTGGCCGATGGTGGCCAACATGCTCGTCCTGGGCGCGCTGCAGGTC
GCCACCATCTACAGCCTCACCTTTCGCCAGTTCCTCGCCGTCCGCGCCCTCTTCGGCCTCTTCATGGGCGGCGTC
TACGGCAACGCCATCGCCATGGCGCTCGAGCAGTGCCCCGTCGCCGCGAGGGGGCTCATGTCCGGCGTGCTGCAG
CAGGGCTACTCGCTCGGCTACGTCCTGGCCGCGTGCGCCAACCTCGGCGTCGGCGGCGGCGCCGACAGCTGGAAG
ACGGTCTTTTGGATCGCCGCCGGCATCTCCATCGGCGTCGGCCTCGTCCGCGTCCTCTTCCCCGAGTCGCCGCAG
TTCCTCGAGGCCCGGCGCCGGCGCCGGGAGCGGGGTGGGGCCGGGGCCGAGGCGGCGTCGGCCGGCGCCTTCTGG
CGCGAGACGCGGCACATGCTGGCGCGCGAGTGGCGCATGTGCGTCTACTGCGTCGTGCTGATGACCTGGTTCAAC
TACTACTCGCACACGTCGCAGGACTCGTACACGACCTTTATGCTGACGCAGAAGCGGCTCGGCAACGCCGGCGCC
TCGCGCGCCTCCATCCTGATGAAGGTCGGCGCCTGCGTCGGCGGCACCATCGTCGGCTACCTCAGCCAGTTCGTC
GGCCGGCGCCGGGCCATCGTCGCCGCCGCCCTCGCCTCGGCCGCCCTCATCCCGGCCTGGATCCTGCCCGAGTCC
GAAGCCGGCCTGAGCGCGGCCGGCTTCTTCCTCCAGTTCTGCGTCCAGGGCGCCTGGGGCGTCATCCCCATCCAC
CTCAACGAGCTGTCGCCCGTCGCCTTCCGCTCCACCTTTCCCGGCCTGACCTACCAGCTCGGCAACATGATCTCG
TCGCCCTCGGCCCAGATCGTCAACGCCATCGCCGAGCGCACCTTCGTCCGCCTCGGCGACGGCTCCCGCGCCGAG
GCCTACGGGCCCGTCATGGGCGTCGCCACCGCCATCATCGCCCTCGGCATCGTCCTCACCACCGCCCTCGGCCCC
GAGCGCCGCGGCCGCAGCTTCCAGCTGCCCGACGCCGCCGACGAGTCCGACGACGCCAAGCTCGCCGCCGACGAC
CATCTTCCTCGCCATCAGCCGTCTCTACCCGACGAGGAAAAGGCCCACGTCGAGGTCCGCGAGGCCAAGTGA
Transcript >Hirsu2|9369
ATGGCGTCGGAGCAGCAAAACGAGCCAGCCGACGACCTGGCCAAGGGCATCCTGCCAACGGCGCGGCAGTCGCTG
CGCGACCTGTTCATCTGGCGGCAGCGCGTCGTCGTGTCCAACGCCGAGGGCGAGACGCGGTGCGAGTGGCAGCGG
CCGGCGCCGCTGCAGAACCCGGCCCGGCTGCTGGCCCGGCTCTCCGCCCGCGACTGGCTCTTCTTCCTGGTCGGG
CTGGCGGCCTGGACGGCCGACGCCTTCGACTTCCACGCGCTGTCGATCCAGACGGTCAAGCTGGCCGGCTACTAC
GGCCGCAGCAAGACGGACATCACGGCTGCCATCACGCTGACGCTGCTCCTGCGCTCCGTCGGCGCCGCCGGCTTC
GGCCTCGCCGGCGACCGCTGGGGCCGCAAGTGGCCGATGGTGGCCAACATGCTCGTCCTGGGCGCGCTGCAGGTC
GCCACCATCTACAGCCTCACCTTTCGCCAGTTCCTCGCCGTCCGCGCCCTCTTCGGCCTCTTCATGGGCGGCGTC
TACGGCAACGCCATCGCCATGGCGCTCGAGCAGTGCCCCGTCGCCGCGAGGGGGCTCATGTCCGGCGTGCTGCAG
CAGGGCTACTCGCTCGGCTACGTCCTGGCCGCGTGCGCCAACCTCGGCGTCGGCGGCGGCGCCGACAGCTGGAAG
ACGGTCTTTTGGATCGCCGCCGGCATCTCCATCGGCGTCGGCCTCGTCCGCGTCCTCTTCCCCGAGTCGCCGCAG
TTCCTCGAGGCCCGGCGCCGGCGCCGGGAGCGGGGTGGGGCCGGGGCCGAGGCGGCGTCGGCCGGCGCCTTCTGG
CGCGAGACGCGGCACATGCTGGCGCGCGAGTGGCGCATGTGCGTCTACTGCGTCGTGCTGATGACCTGGTTCAAC
TACTACTCGCACACGTCGCAGGACTCGTACACGACCTTTATGCTGACGCAGAAGCGGCTCGGCAACGCCGGCGCC
TCGCGCGCCTCCATCCTGATGAAGGTCGGCGCCTGCGTCGGCGGCACCATCGTCGGCTACCTCAGCCAGTTCGTC
GGCCGGCGCCGGGCCATCGTCGCCGCCGCCCTCGCCTCGGCCGCCCTCATCCCGGCCTGGATCCTGCCCGAGTCC
GAAGCCGGCCTGAGCGCGGCCGGCTTCTTCCTCCAGTTCTGCGTCCAGGGCGCCTGGGGCGTCATCCCCATCCAC
CTCAACGAGCTGTCGCCCGTCGCCTTCCGCTCCACCTTTCCCGGCCTGACCTACCAGCTCGGCAACATGATCTCG
TCGCCCTCGGCCCAGATCGTCAACGCCATCGCCGAGCGCACCTTCGTCCGCCTCGGCGACGGCTCCCGCGCCGAG
GCCTACGGGCCCGTCATGGGCGTCGCCACCGCCATCATCGCCCTCGGCATCGTCCTCACCACCGCCCTCGGCCCC
GAGCGCCGCGGCCGCAGCTTCCAGCTGCCCGACGCCGCCGACGAGTCCGACGACGCCAAGCTCGCCGCCGACGAC
CATCTTCCTCGCCATCAGCCGTCTCTACCCGACGAGGAAAAGGCCCACGTCGAGGTCCGCGAGGCCAAGTGA
Gene >Hirsu2|9369
ATGGCGTCGGAGCAGCAAAACGAGCCAGCCGACGACCTGGCCAAGGGCATCCTGCCAACGGCGCGGCAGTCGCTG
CGCGACCTGTTCATCTGGCGGCAGCGCGTCGTCGTGTCCAACGCCGAGGGCGAGACGCGGTGCGAGTGGCAGCGG
CCGGCGCCGCTGCAGAACCCGGCCCGGCTGCTGGCCCGGCTCTCCGCCCGCGACTGGCTCTTCTTCCTGGTCGGG
CTGGCGGCCTGGACGGCCGACGCCTTCGACTTCCACGCGCTGTCGATCCAGACGGTCAAGCTGGCCGGCTACTAC
GGCCGCAGCAAGACGGACATCACGGCTGCCATCACGCTGACGCTGCTCCTGCGCTCCGTCGGCGCCGCCGGCTTC
GGCCTCGCCGGCGACCGCTGGGGCCGCAAGTGGCCGATGGTGGCCAACATGCTCGTCCTGGGCGCGCTGCAGGTC
GCCACCATCTACAGCCTCACCTTTCGCCAGTTCCTCGCCGTCCGCGCCCTCTTCGGCCTCTTCATGGGCGGCGTC
TACGGCAACGCCATCGCCATGGCGCTCGAGCAGTGCCCCGTCGCCGCGAGGGGGCTCATGTCCGGCGTGCTGCAG
CAGGGCTACTCGCTCGGCTACGTCCTGGCCGCGTGCGCCAACCTCGGCGTCGGCGGCGGCGCCGACAGCTGGAAG
ACGGTCTTTTGGATCGCCGGTCCGCTTTACCCCCCACCCGTCTCTCTCCGGCACAAGAATCATGTACGTGTGCTG
ATGCTTGTTTCTTTAGCCGGCATCTCCATCGGCGTCGGCCTCGTCCGCGTCCTCTTCCCCGAGTCGCCGCAGTTC
CTCGAGGCCCGGCGCCGGCGCCGGGAGCGGGGTGGGGCCGGGGCCGAGGCGGCGTCGGCCGGCGCCTTCTGGCGC
GAGACGCGGCACATGCTGGCGCGCGAGTGGCGCATGTGCGTCTACTGCGTCGTGCTGATGACCTGGTTCAACTAC
TACTCGCACACGTCGCAGGACTCGTACACGACCTTTATGCTGACGCAGAAGCGGCTCGGCAACGCCGGCGCCTCG
CGCGCCTCCATCCTGATGAAGGTCGGCGCCTGCGTCGGCGGCACCATCGTCGGCTACCTCAGCCAGTTCGTCGGC
CGGCGCCGGGCCATCGTCGCCGCCGCCCTCGCCTCGGCCGCCCTCATCCCGGCCTGGATCCTGCCCGAGTCCGAA
GCCGGCCTGAGCGCGGCCGGCTTCTTCCTCCAGTTCTGCGTCCAGGGCGCCTGGGGCGTCATCCCCATCCACCTC
AACGAGCTGTCGCCCGTCGCCTTCCGCTCCACCTTTCCCGGCCTGACCTACCAGCTCGGCAACATGATCTCGTCG
CCCTCGGCCCAGATCGTCAACGCCATCGCCGAGCGCACCTTCGTCCGCCTCGGCGACGGCTCCCGCGCCGAGGCC
TACGGGCCCGTCATGGGCGTCGCCACCGCCATCATCGCCCTCGGCATCGTCCTCACCACCGCCCTCGGCCCCGAG
CGCCGCGGCCGCAGCTTCCAGCTGCCCGACGCCGCCGACGAGTCCGACGACGCCAAGCTCGCCGCCGACGACCAT
CTTCCTCGCCATCAGCCGTCTCTACCCGACGAGGAAAAGGCCCACGTCGAGGTCCGCGAGGCCAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail