Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9361
Gene name
LocationContig_676:80..1323
Strand-
Gene length (bp)1243
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.6E-47 182 347
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.9E-19 75 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 72 346 5.0E-63
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 78 346 3.0E-59
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 35 346 2.0E-53
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 79 336 3.0E-25
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 78 336 6.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 72 346 5.0E-63
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 78 346 3.0E-59
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 35 346 2.0E-53
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 79 336 3.0E-25
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 78 336 6.0E-25
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 79 353 9.0E-22
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 77 353 7.0E-21
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 80 353 1.0E-20
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 79 348 2.0E-20
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 80 348 4.0E-20
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 78 353 4.0E-20
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 79 348 4.0E-19
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 73 353 9.0E-18
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 88 348 1.0E-15
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 127 346 2.0E-15
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 41 348 1.0E-14
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 131 334 7.0E-14
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 129 332 2.0E-09
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 131 346 3.0E-09
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 86 348 1.0E-08
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 79 344 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 185 207 22
3 227 249 22
4 281 303 22
5 325 347 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9361
MSKVPPLLEPLLRLPPEAALVVLTGVLGASTNWLLLRWIHALLRSRRRPSEAQDDDDVAAAAADAETANIAARYV
PDKKRPSHRLGPLGLVGKKVDTIEWCRSELQRLVPETDRAQAEWRAGNFEKVHAVFVEFHTQADAQAAYQVLTHH
RALHMCPKVVGVRPEEVVWKSLSIPWWQVVVRRYAVYAFIAALIIFWAIPVAVVTLITQVSVLKNLPGLGWIGSI
PQSILGVVSGLLPAVAMSILMSLVPVVMRWCAKLAGAPTLSQAELFTQNAYFAFQLIQVFLVQTVLGSGVSALLN
IIIQPPTSIFSILGQKLPTSANFYISYFIVQGLTIATGVLTQVVGLFPPARLHQHYRHQ*
Coding >Hirsu2|9361
ATGTCCAAGGTCCCGCCGCTGCTGGAGCCGCTGCTGCGGCTGCCGCCCGAGGCCGCCCTCGTCGTCCTGACGGGC
GTCCTGGGCGCCAGCACCAACTGGCTGCTCCTGCGCTGGATCCACGCGCTGCTGCGCAGCCGGCGGCGGCCCAGC
GAGGCGCAGGACGACGACGACGTCGCCGCCGCCGCCGCCGACGCCGAGACGGCCAACATCGCCGCCCGCTACGTC
CCCGACAAGAAGCGCCCCTCGCACCGGCTCGGGCCCCTCGGCCTCGTCGGCAAAAAGGTCGACACCATCGAGTGG
TGCCGCTCCGAGCTGCAGCGCCTCGTGCCCGAGACGGACCGCGCCCAGGCCGAGTGGCGCGCCGGCAACTTCGAA
AAGGTGCACGCCGTCTTCGTCGAGTTCCACACCCAGGCCGACGCCCAGGCCGCCTACCAGGTCCTCACCCACCAC
CGCGCCCTGCACATGTGCCCCAAGGTCGTCGGCGTCCGGCCCGAGGAGGTGGTGTGGAAGAGCCTGTCGATCCCG
TGGTGGCAGGTCGTCGTCCGCCGCTACGCCGTCTACGCCTTCATCGCCGCCCTCATCATCTTCTGGGCCATCCCC
GTCGCCGTCGTCACCCTCATCACCCAGGTCTCCGTCCTCAAGAACCTGCCCGGCCTCGGCTGGATCGGCAGCATC
CCGCAGTCGATCCTCGGCGTCGTCTCGGGCCTGCTCCCGGCCGTGGCCATGTCGATCCTCATGTCGCTCGTGCCC
GTCGTCATGCGCTGGTGCGCCAAGCTGGCCGGCGCCCCCACCCTGTCCCAGGCCGAGCTCTTCACCCAGAATGCC
TACTTCGCCTTCCAGCTCATTCAGGTCTTCCTCGTCCAGACGGTCCTCGGCTCGGGCGTGTCGGCCCTGCTCAAC
ATCATCATCCAGCCCCCGACGAGCATCTTCAGCATCCTGGGCCAGAAGCTGCCGACGTCGGCCAACTTCTACATC
TCGTACTTCATCGTCCAGGGCCTCACCATCGCCACCGGCGTCCTGACCCAGGTCGTCGGCCTCTTCCCTCCTGCC
CGTCTACACCAACATTATCGCCATCAGTGA
Transcript >Hirsu2|9361
ATGTCCAAGGTCCCGCCGCTGCTGGAGCCGCTGCTGCGGCTGCCGCCCGAGGCCGCCCTCGTCGTCCTGACGGGC
GTCCTGGGCGCCAGCACCAACTGGCTGCTCCTGCGCTGGATCCACGCGCTGCTGCGCAGCCGGCGGCGGCCCAGC
GAGGCGCAGGACGACGACGACGTCGCCGCCGCCGCCGCCGACGCCGAGACGGCCAACATCGCCGCCCGCTACGTC
CCCGACAAGAAGCGCCCCTCGCACCGGCTCGGGCCCCTCGGCCTCGTCGGCAAAAAGGTCGACACCATCGAGTGG
TGCCGCTCCGAGCTGCAGCGCCTCGTGCCCGAGACGGACCGCGCCCAGGCCGAGTGGCGCGCCGGCAACTTCGAA
AAGGTGCACGCCGTCTTCGTCGAGTTCCACACCCAGGCCGACGCCCAGGCCGCCTACCAGGTCCTCACCCACCAC
CGCGCCCTGCACATGTGCCCCAAGGTCGTCGGCGTCCGGCCCGAGGAGGTGGTGTGGAAGAGCCTGTCGATCCCG
TGGTGGCAGGTCGTCGTCCGCCGCTACGCCGTCTACGCCTTCATCGCCGCCCTCATCATCTTCTGGGCCATCCCC
GTCGCCGTCGTCACCCTCATCACCCAGGTCTCCGTCCTCAAGAACCTGCCCGGCCTCGGCTGGATCGGCAGCATC
CCGCAGTCGATCCTCGGCGTCGTCTCGGGCCTGCTCCCGGCCGTGGCCATGTCGATCCTCATGTCGCTCGTGCCC
GTCGTCATGCGCTGGTGCGCCAAGCTGGCCGGCGCCCCCACCCTGTCCCAGGCCGAGCTCTTCACCCAGAATGCC
TACTTCGCCTTCCAGCTCATTCAGGTCTTCCTCGTCCAGACGGTCCTCGGCTCGGGCGTGTCGGCCCTGCTCAAC
ATCATCATCCAGCCCCCGACGAGCATCTTCAGCATCCTGGGCCAGAAGCTGCCGACGTCGGCCAACTTCTACATC
TCGTACTTCATCGTCCAGGGCCTCACCATCGCCACCGGCGTCCTGACCCAGGTCGTCGGCCTCTTCCCTCCTGCC
CGTCTACACCAACATTATCGCCATCAGTGA
Gene >Hirsu2|9361
ATGTCCAAGGTCCCGCCGCTGCTGGAGCCGCTGCTGCGGCTGCCGCCCGAGGCCGCCCTCGTCGTCCTGACGGGC
GTCCTGGGCGCCAGCACCAACTGGCTGCTCCTGCGCTGGATCCACGCGCTGCTGCGCAGCCGGCGGCGGCCCAGC
GAGGCGCAGGACGACGACGACGTCGCCGCCGCCGCCGCCGACGCCGAGACGGCCAACATCGCCGCCCGCTACGTC
CCCGACAAGAAGCGCCCCTCGCACCGGCTCGGGCCCCTCGGCCTCGTCGGCAAAAAGGTCGACACCATCGAGTGG
TGCCGCTCCGAGCTGCAGCGCCTCGTGCCCGAGACGGACCGCGCCCAGGCCGAGTGGCGCGCCGGCAACTTCGAA
AAGGTGCACGCCGTCTTCGTCGAGTTCCACACCCAGGCCGACGCCCAGGCCGCCTACCAGGTCCTCACCCACCAC
CGCGCCCTGCACATGTGCCCCAAGGTCGTCGGCGTCCGGCCCGAGGAGGTGGTGTGGAAGAGCCTGTCGATCCCG
TGGTGGCAGGTCGTCGTCCGCCGCTACGCCGTCTACGCCTTCATCGCCGCCCTCATCATCTTCTGGGCCATCCCC
GTCGCCGTCGTCACCCTCATCACCCAGGTCTCCGTCCTCAAGAACCTGCCCGGCCTCGGCTGGATCGGCAGCATC
CCGCAGGTGCGTCGTCGCCGCCCCCCTTCCTTGCTCGTCTTGTGCCCGCCGTGCTGACTCTCTCGCCTCCCCCCC
CTCAGTCGATCCTCGGCGTCGTCTCGGGCCTGCTCCCGGCCGTGGCCATGTCGATCCTCATGTCGCTCGTGCCCG
TCGTCATGCGCTGGTGCGCCAAGCTGGCCGGCGCCCCCACCCTGTCCCAGGCCGAGCTCTTCACCCAGAATGCCT
ACTTCGCCTTCCAGCTCATTCAGGTCTTCCTCGTCCAGACGGTCCTCGGCTCGGGCGTGTCGGCCCTGCTCAACA
TCATCATCCAGCCCCCGACGAGCATCTTCAGCATCCTGGGCCAGAAGCTGCCGACGTCGGCCAACTTCTACATCT
CGTACTTCATCGTCCAGGGCCTCACCATCGCCACCGGCGTCCTGACCCAGGTCGTCGGCCTCTTCGTCTTCCGCC
TCATGTACAAGTTCCTCACCGGCACCCCGCGCGCCATGTACACCAAGTGGACGACGCTCAGCGCCATCCTGTGGG
GCAGCCTCCTGCCCGTCTACACCAACATTATCGCCATCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail