Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9356
Gene name
LocationContig_675:2531..4971
Strand-
Gene length (bp)2440
Transcript length (bp)2010
Coding sequence length (bp)2010
Protein length (aa) 670

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain 1.9E-48 20 155
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 2.4E-09 369 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q27ID4|TERT_BOVIN Telomerase reverse transcriptase OS=Bos taurus GN=TERT PE=3 SV=2 20 665 6.0E-71
sp|O14746|TERT_HUMAN Telomerase reverse transcriptase OS=Homo sapiens GN=TERT PE=1 SV=1 20 665 2.0E-68
sp|Q6A548|TERT_CANLF Telomerase reverse transcriptase OS=Canis lupus familiaris GN=TERT PE=2 SV=1 20 612 3.0E-68
sp|O13339|TERT_SCHPO Telomerase reverse transcriptase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trt1 PE=1 SV=1 20 556 3.0E-67
sp|Q673L6|TERT_RAT Telomerase reverse transcriptase OS=Rattus norvegicus GN=Tert PE=2 SV=1 4 661 8.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q27ID4|TERT_BOVIN Telomerase reverse transcriptase OS=Bos taurus GN=TERT PE=3 SV=2 20 665 6.0E-71
sp|O14746|TERT_HUMAN Telomerase reverse transcriptase OS=Homo sapiens GN=TERT PE=1 SV=1 20 665 2.0E-68
sp|Q6A548|TERT_CANLF Telomerase reverse transcriptase OS=Canis lupus familiaris GN=TERT PE=2 SV=1 20 612 3.0E-68
sp|O13339|TERT_SCHPO Telomerase reverse transcriptase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trt1 PE=1 SV=1 20 556 3.0E-67
sp|Q673L6|TERT_RAT Telomerase reverse transcriptase OS=Rattus norvegicus GN=Tert PE=2 SV=1 4 661 8.0E-64
sp|Q1PS67|TERT_ORYLA Telomerase reverse transcriptase OS=Oryzias latipes GN=tert PE=1 SV=2 6 564 7.0E-61
sp|O70372|TERT_MOUSE Telomerase reverse transcriptase OS=Mus musculus GN=Tert PE=1 SV=1 20 612 7.0E-59
sp|Q4KTA7|TERT_TAKRU Telomerase reverse transcriptase OS=Takifugu rubripes GN=tert PE=1 SV=1 5 661 3.0E-55
sp|Q8LKW0|TERT_ORYSJ Telomerase reverse transcriptase OS=Oryza sativa subsp. japonica GN=TERT PE=2 SV=2 20 655 3.0E-53
sp|O76332|TERT_OXYTR Telomerase reverse transcriptase OS=Oxytricha trifallax GN=TERT PE=3 SV=1 20 584 4.0E-40
sp|O00939|TERT_EUPAE Telomerase reverse transcriptase OS=Euplotes aediculatus PE=3 SV=1 10 656 9.0E-35
sp|Q9SPU7|TERT_ARATH Telomerase reverse transcriptase OS=Arabidopsis thaliana GN=TERT PE=1 SV=1 12 656 9.0E-34
sp|O77448|TERT_TETTH Telomerase reverse transcriptase OS=Tetrahymena thermophila GN=TERT PE=1 SV=1 8 505 1.0E-32
sp|Q06163|TERT_YEAST Telomerase reverse transcriptase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EST2 PE=1 SV=2 108 565 7.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0003964 RNA-directed DNA polymerase activity Yes
GO:0140097 catalytic activity, acting on DNA No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0034061 DNA polymerase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9356
MPPPSEQTSLVELACPASCVSAFCQAVMSKTIPNGFWGEGDTMCHNRATFLHKVDHFIKLRRFESMTLHEISQGQ
KVVDIAWLRPPGCHGQRLSQGDMNKRQEMFHEFLYYVFDSLLIPLIRSNFYVTESSTHRYEMFYFRHDVWKLATE
PSLSALRSSMFEEVKLEEAQRLLNSRRLGYGHLRLLPKGNKFRPIVNLRRRNLSASSSKALNPSINSILGPIHTV
LKFEKDTNPLRLGSSLLSVGDVYHRLKRFKESLGPEERRLYLAKIDVHAAFDTIPQAPVTELMAGIFSQRLYTIK
KHVEVRPGERSMPEPSRAATRALKRWRSTAAGDGRVEPLLERLKRELGGHRKNTIFVESAAHKTCSVESLVSLLA
DHVERHLVRFGRKYFRQSRGIPQGSVLSSSLCNYFYADLEMRHLGFLSSPDCLLMRLVDDFLLISLDEAKAAAFV
RTMHGGLPDYGVEVSREKTLVNFDLEVEGREVRKVPQGQGFPYCGMLIDSRSLDIAKDRRRGDGVAVANSLTVDF
GRSPGHNFQRKILNAFKIQSHLMFYDTSHNSNDAVLQSLEGAFCETGRKMWAYIRCFPRPQRPSGSLIIQTITKV
ANIAFLILSGKSRRTKYPRYSFDIRKRQVSSIAHSSFLEILSQKQTGYSQVISWLRRQHRRETPGRLSA*
Coding >Hirsu2|9356
ATGCCGCCTCCCTCGGAGCAAACGTCGCTGGTGGAACTGGCCTGTCCAGCCTCTTGCGTTTCGGCCTTTTGCCAA
GCCGTCATGTCCAAGACCATACCCAACGGCTTTTGGGGCGAGGGTGATACCATGTGCCACAACAGGGCGACGTTT
CTGCACAAGGTCGATCACTTCATCAAACTGCGACGGTTCGAGTCCATGACGTTGCACGAAATCTCCCAGGGCCAA
AAGGTGGTCGACATCGCCTGGCTTCGGCCGCCAGGCTGCCACGGCCAAAGGCTTAGTCAAGGCGACATGAACAAA
CGACAAGAGATGTTCCACGAATTCCTGTACTACGTCTTCGACTCTCTCTTGATACCGCTCATTCGGAGCAATTTC
TACGTGACAGAGTCCAGCACGCATCGTTATGAGATGTTCTACTTCCGTCATGATGTCTGGAAGCTCGCCACGGAA
CCCTCTCTGTCCGCGCTCAGGAGCAGCATGTTTGAGGAGGTGAAGCTTGAGGAGGCGCAGCGGCTCCTGAACTCG
AGACGGCTCGGATACGGCCACCTACGTCTCCTACCGAAGGGCAACAAATTTCGACCCATCGTCAACCTCCGCAGG
AGGAATCTGAGCGCATCCTCCTCAAAGGCCCTAAACCCCAGTATCAACTCGATCCTCGGCCCCATCCACACCGTC
CTTAAGTTCGAAAAGGATACGAATCCGCTCCGCCTGGGCTCGAGTCTCTTGTCTGTCGGCGATGTGTACCATCGA
CTCAAACGGTTCAAGGAGTCGCTGGGGCCCGAGGAGCGGCGTCTTTACTTGGCTAAGATCGATGTGCATGCTGCC
TTCGATACGATTCCCCAAGCGCCCGTTACCGAACTGATGGCCGGCATTTTCAGCCAGAGGCTGTATACGATTAAG
AAACATGTCGAAGTGCGGCCGGGTGAGCGCTCGATGCCGGAGCCCAGCAGAGCCGCGACCAGGGCTTTGAAGCGG
TGGCGTTCGACAGCGGCAGGAGACGGCCGGGTCGAACCTCTCCTGGAGCGACTGAAGAGAGAGCTCGGTGGACAC
AGGAAGAACACAATTTTTGTCGAAAGTGCCGCGCACAAGACTTGCAGTGTCGAGTCCCTCGTCAGCCTCCTGGCC
GATCACGTGGAGCGGCACCTCGTCAGGTTTGGCAGAAAGTACTTCCGCCAAAGTAGAGGCATACCGCAAGGATCG
GTCCTCTCGTCCTCGCTATGCAACTACTTCTACGCCGATCTCGAGATGCGGCACTTGGGCTTCTTGAGCTCGCCT
GACTGCTTGTTGATGCGGCTCGTGGACGACTTTCTCCTCATCAGCCTCGACGAGGCCAAGGCCGCTGCTTTTGTC
CGGACGATGCACGGCGGACTTCCGGACTACGGGGTGGAGGTGAGTCGGGAAAAGACGCTGGTCAACTTCGACCTC
GAGGTCGAGGGCCGGGAGGTGCGGAAGGTGCCACAAGGGCAGGGATTCCCCTACTGCGGCATGCTCATCGATAGT
CGGTCTCTGGATATCGCCAAGGACCGGAGGCGAGGCGACGGAGTTGCTGTCGCCAACTCGCTCACGGTCGACTTT
GGGCGTTCGCCGGGCCACAACTTTCAAAGGAAAATCCTGAACGCGTTCAAGATCCAGTCTCATCTCATGTTCTAC
GATACCTCCCACAACTCAAATGACGCCGTGCTACAGTCGCTCGAAGGTGCCTTTTGCGAGACCGGTCGCAAGATG
TGGGCTTATATCCGTTGCTTTCCTCGGCCACAGAGGCCTAGTGGTAGCCTCATCATCCAGACGATTACCAAAGTC
GCGAACATCGCCTTTCTCATCTTGTCTGGAAAGTCTAGAAGGACGAAGTATCCGCGCTACAGCTTTGATATTCGA
AAAAGGCAGGTCTCCAGCATTGCTCATTCGTCTTTCTTGGAGATACTGAGCCAGAAACAGACCGGTTATAGTCAA
GTCATATCGTGGCTTCGACGACAACATAGGAGGGAGACTCCGGGGCGGCTGAGCGCTTGA
Transcript >Hirsu2|9356
ATGCCGCCTCCCTCGGAGCAAACGTCGCTGGTGGAACTGGCCTGTCCAGCCTCTTGCGTTTCGGCCTTTTGCCAA
GCCGTCATGTCCAAGACCATACCCAACGGCTTTTGGGGCGAGGGTGATACCATGTGCCACAACAGGGCGACGTTT
CTGCACAAGGTCGATCACTTCATCAAACTGCGACGGTTCGAGTCCATGACGTTGCACGAAATCTCCCAGGGCCAA
AAGGTGGTCGACATCGCCTGGCTTCGGCCGCCAGGCTGCCACGGCCAAAGGCTTAGTCAAGGCGACATGAACAAA
CGACAAGAGATGTTCCACGAATTCCTGTACTACGTCTTCGACTCTCTCTTGATACCGCTCATTCGGAGCAATTTC
TACGTGACAGAGTCCAGCACGCATCGTTATGAGATGTTCTACTTCCGTCATGATGTCTGGAAGCTCGCCACGGAA
CCCTCTCTGTCCGCGCTCAGGAGCAGCATGTTTGAGGAGGTGAAGCTTGAGGAGGCGCAGCGGCTCCTGAACTCG
AGACGGCTCGGATACGGCCACCTACGTCTCCTACCGAAGGGCAACAAATTTCGACCCATCGTCAACCTCCGCAGG
AGGAATCTGAGCGCATCCTCCTCAAAGGCCCTAAACCCCAGTATCAACTCGATCCTCGGCCCCATCCACACCGTC
CTTAAGTTCGAAAAGGATACGAATCCGCTCCGCCTGGGCTCGAGTCTCTTGTCTGTCGGCGATGTGTACCATCGA
CTCAAACGGTTCAAGGAGTCGCTGGGGCCCGAGGAGCGGCGTCTTTACTTGGCTAAGATCGATGTGCATGCTGCC
TTCGATACGATTCCCCAAGCGCCCGTTACCGAACTGATGGCCGGCATTTTCAGCCAGAGGCTGTATACGATTAAG
AAACATGTCGAAGTGCGGCCGGGTGAGCGCTCGATGCCGGAGCCCAGCAGAGCCGCGACCAGGGCTTTGAAGCGG
TGGCGTTCGACAGCGGCAGGAGACGGCCGGGTCGAACCTCTCCTGGAGCGACTGAAGAGAGAGCTCGGTGGACAC
AGGAAGAACACAATTTTTGTCGAAAGTGCCGCGCACAAGACTTGCAGTGTCGAGTCCCTCGTCAGCCTCCTGGCC
GATCACGTGGAGCGGCACCTCGTCAGGTTTGGCAGAAAGTACTTCCGCCAAAGTAGAGGCATACCGCAAGGATCG
GTCCTCTCGTCCTCGCTATGCAACTACTTCTACGCCGATCTCGAGATGCGGCACTTGGGCTTCTTGAGCTCGCCT
GACTGCTTGTTGATGCGGCTCGTGGACGACTTTCTCCTCATCAGCCTCGACGAGGCCAAGGCCGCTGCTTTTGTC
CGGACGATGCACGGCGGACTTCCGGACTACGGGGTGGAGGTGAGTCGGGAAAAGACGCTGGTCAACTTCGACCTC
GAGGTCGAGGGCCGGGAGGTGCGGAAGGTGCCACAAGGGCAGGGATTCCCCTACTGCGGCATGCTCATCGATAGT
CGGTCTCTGGATATCGCCAAGGACCGGAGGCGAGGCGACGGAGTTGCTGTCGCCAACTCGCTCACGGTCGACTTT
GGGCGTTCGCCGGGCCACAACTTTCAAAGGAAAATCCTGAACGCGTTCAAGATCCAGTCTCATCTCATGTTCTAC
GATACCTCCCACAACTCAAATGACGCCGTGCTACAGTCGCTCGAAGGTGCCTTTTGCGAGACCGGTCGCAAGATG
TGGGCTTATATCCGTTGCTTTCCTCGGCCACAGAGGCCTAGTGGTAGCCTCATCATCCAGACGATTACCAAAGTC
GCGAACATCGCCTTTCTCATCTTGTCTGGAAAGTCTAGAAGGACGAAGTATCCGCGCTACAGCTTTGATATTCGA
AAAAGGCAGGTCTCCAGCATTGCTCATTCGTCTTTCTTGGAGATACTGAGCCAGAAACAGACCGGTTATAGTCAA
GTCATATCGTGGCTTCGACGACAACATAGGAGGGAGACTCCGGGGCGGCTGAGCGCTTGA
Gene >Hirsu2|9356
ATGCCGCCTCCCTCGGAGCAAACGTCGCTGGTGGAACTGGCCTGTCCAGCCTCTTGCGTTTCGGCCTTTTGCCAA
GCCGTCATGTCCAAGACCATACCCAACGGCTTTTGGGGCGAGGGTGATACCATGTGCCACAACAGGGCGACGTTT
CTGCACAAGGTCGATCACTTCATCAAACTGCGACGGTTCGAGTCCATGACGTTGCACGAAATCTCCCAGGGCCAA
AAGGTAAGCCCAGTCCGTCCCGCGGCCGGGCCTGAGCATTGAGCCGCCTCCCCATCGACACTCACACGATTGCCT
AGGTGGTCGACATCGCCTGGCTTCGGCCGCCAGGCTGCCACGGCCAAAGGCTTAGTCAAGGCGACATGAACAAAC
GACAAGAGATGTTCCACGAATTCCTGTACTACGTCTTCGACTCTCTCTTGATACCGCTCATTCGGAGCAATTTCT
ACGTGACAGAGTCCAGCACGCATCGTTATGAGATGTTCTACTTCCGTCATGATGTCTGGAAGCTCGCCACGGAAC
CCTCTCTGTCCGCGCTCAGGAGCAGCATGTTTGAGGAGGTGAAGCTTGAGGAGGCGCAGCGGCTCCTGAACTCGA
GACGGCTCGGATACGGCCACCTACGTCTCCTACCGAAGGGCAACAAATTTCGACCCATCGTCAACCTCCGCAGGA
GGAATCTGAGCGCATCCTCCTCAAAGGCCCTAAACCCCAGTATCAACTCGATCCTCGGCCCCATCCACACCGTCC
TTAAGTTCGAAAAGGTGCCTGTGCAGTTTCCGCTACTCCTTGTCCATTGGGTGTGCTAATTGACGCAGGATACGA
ATCCGCTCCGCCTGGGCTCGAGTCTCTTGTCTGTCGGCGATGTGTACCATCGACTCAAACGGTTCAAGGAGTCGC
TGGGGCCCGAGGAGCGGCGTCTTTACTTGGCTAAGATCGATGTGCATGCTGCCTTCGATACGATTCCCCAAGCGC
CCGTTACCGAACTGATGGCCGGCATTTTCAGCCAGAGGCTGTATACGATTAAGAAACATGTCGAAGTGCGGCCGG
GTGAGCGCTCGATGCCGGAGCCCAGCAGAGCCGCGACCAGGGCTTTGAAGCGGTGGCGTTCGACAGCGGCAGGAG
ACGGCCGGGTCGAACCTCTCCTGGAGCGACTGAAGAGAGAGCTCGGTGGACACAGGAAGAACACAATTTTTGTCG
AAAGTGCCGCGCACAAGACTTGCAGTGTCGAGTCCCTCGTCAGCCTCCTGGCCGATCACGTGGAGCGGCACCTCG
TCAGGTTTGGCAGAAAGTACTTCCGCCAAAGTAGAGGCATACCGCAAGGATCGGTCCTCTCGTCCTCGCTATGCA
ACTACTTCTACGCCGATCTCGAGATGCGGCACTTGGGCTTCTTGAGCTCGCCTGACTGCTTGTTGATGCGGCTCG
TGGACGACTTTCTCCTCATCAGCCTCGACGAGGCCAAGGCCGCTGCTTTTGTCCGGACGATGCACGGCGGACTTC
CGGACTACGGGGTGGAGGTGAGTCGGGAAAAGACGCTGGTCAACTTCGACCTCGAGGTCGAGGGCCGGGAGGTGC
GGAAGGTGCCACAAGGGCAGGGATTCCCCTACTGCGGCATGCTCATCGATAGTCGGTCTCTGGATATCGCCAAGG
ACCGGAGGCGAGGCGACGGAGTTGGTAAGATAATGAAGCCCGTCGTCCGGCAAGGCCAAACGCAAGTTGACGAAA
TCTCAGCTGTCGCCAACTCGCTCACGGTCGACTTTGGGCGTTCGCCGGGCCACAACTTTCAAAGGAAAATCCTGA
GTGAGTCAAGCACATGTCTGATTCTGCGAGCAAACCATTTCGTGGAATTTACCGCCAAAGACTGCCGAAAAAAAA
AAAAGGAACCCTGAAGGAAAAAACTAACTGGTCAATCTCTTCTCCAGACGCGTTCAAGATCCAGTCTCATCTCAT
GTTCTACGATACCTCCCACAACTCAAATGACGCCGTGCTACAGTCGCTCGAAGGTGCCTTTTGCGAGACCGGTCG
CAAGATGTGGGCTTATATCCGTTGCTTTCCTCGGCCACAGAGGCCTAGTGGTAGCCTCATCATCCGTGAGTGAGG
AGCGCATGTCCAACCGCCGATTGCTCGACCCGCCCACCTGACGGCTGCGCAGAGACGATTACCAAAGTCGCGAAC
ATCGCCTTTCTCATCTTGTCTGGAAAGTCTAGAAGGACGAAGTATCCGCGCTACAGCTTTGATATTCGAAAAAGG
CAGGTCTCCAGGTGAGATGACCGCAACTGCGACTCGGCGACTCTGCCTGCCGACTTGCTGACGCACCCCCAGCAT
TGCTCATTCGTCTTTCTTGGAGATACTGAGCCAGAAACAGACCGGTTATAGTCAAGTCATATCGTGGCTTCGACG
ACAACATAGGAGGGAGACTCCGGGGCGGCTGAGCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail