Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9355
Gene name
LocationContig_675:712..2367
Strand+
Gene length (bp)1655
Transcript length (bp)1596
Coding sequence length (bp)1596
Protein length (aa) 532

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13813 MBOAT_2 Membrane bound O-acyl transferase family 8.2E-16 340 428

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 60 79 19
3 83 105 22
4 389 411 22
5 426 448 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9355
MDRAWDSARAARRADFAQAVADGRLTPFLVLHSLLVSMIVPTLWLSIPHVRRPRLYQTRWLVVAFVAACNLHLIW
TSSSANVFSAYFMGVFISSGILVTMNLLVWRRPQFDAARAVRALAPLKRPPPDQMAGSTPYDPRPSPNRDGTPGH
EDRDAASFRSWRTEAALDDGLFVWQPFPADAPFSDRFGWALDLVLSNRGSGWNSSISSIPHPPVDLPVGPGQPVR
LRSMPRVTRSGYERCFTEGEFVRKRLLEVLAKYLVLDCCHVAMTKDPYFVLGADHAHRHPSHLLALPAWQLHLYR
QLIFLLFITSLLRIVSAINDLVQYWVFKIYFSSRAALWLYPSYFGSFSRVLDAGLAGWWGGWWHQTLRQPFSAPA
TYLRTHGYIKAGSSLAAAVTIFVSFLQSGLVHAAASMTATPATTVWRPIAFFLLQPVGILVQKTLVWLVQYLVPR
PPRVVARTANLLFALAWLHLTADFFVDDFACGGVTLLELIPFSPLRWLAYGHATGHWWRWNRQMLPSWHSGKYWW
MSGIAI*
Coding >Hirsu2|9355
ATGGACAGAGCGTGGGACAGCGCGCGCGCCGCTCGCCGCGCCGACTTCGCCCAGGCCGTGGCCGACGGCCGACTC
ACGCCCTTTCTCGTCCTCCACAGCCTCCTCGTCTCCATGATCGTGCCCACCCTGTGGCTCAGCATCCCCCACGTG
CGCCGCCCGCGCCTCTACCAGACGCGCTGGCTCGTCGTCGCCTTCGTCGCCGCCTGCAACCTCCACCTCATCTGG
ACGTCGTCCAGCGCCAACGTATTCTCCGCTTACTTCATGGGCGTGTTTATCTCCTCCGGCATTCTTGTAACCATG
AACCTGCTTGTTTGGAGGCGGCCCCAGTTCGACGCGGCAAGGGCCGTCCGGGCTCTGGCTCCTTTGAAACGACCG
CCCCCGGACCAGATGGCCGGCAGCACCCCATACGACCCTCGCCCTTCTCCAAACAGGGACGGGACGCCGGGGCAC
GAGGACCGCGACGCCGCCTCCTTCCGGTCGTGGCGGACAGAGGCCGCCCTGGATGATGGCCTGTTCGTCTGGCAA
CCTTTTCCCGCTGACGCGCCCTTCTCAGACCGCTTCGGATGGGCTTTGGATCTGGTGCTGAGCAATCGAGGCTCA
GGTTGGAACTCGTCCATATCGTCTATCCCGCACCCTCCAGTGGATCTTCCTGTCGGCCCGGGTCAGCCCGTGCGC
CTCCGATCCATGCCCCGTGTGACAAGAAGCGGATACGAACGGTGCTTCACTGAGGGCGAATTCGTGCGGAAGCGG
CTCCTTGAGGTGCTGGCCAAGTATCTGGTCCTTGATTGCTGCCACGTCGCCATGACCAAGGATCCCTACTTCGTC
CTTGGGGCCGACCATGCCCATCGACACCCATCCCATTTACTTGCCTTGCCGGCCTGGCAGCTGCATCTTTACAGG
CAGCTCATATTCCTCCTTTTCATCACGTCACTTCTTCGAATTGTCAGCGCCATCAACGACCTTGTCCAATACTGG
GTCTTCAAGATCTACTTTTCCAGCCGGGCCGCACTCTGGTTATACCCCTCATATTTTGGCTCCTTTTCCCGCGTC
CTCGATGCCGGTCTCGCCGGCTGGTGGGGGGGGTGGTGGCACCAAACCCTCCGACAGCCCTTCTCCGCCCCAGCG
ACGTATCTCCGCACACACGGTTACATCAAGGCCGGCAGCTCCCTGGCGGCCGCCGTCACCATCTTCGTGTCCTTC
CTTCAGTCCGGGCTGGTGCATGCCGCCGCGAGCATGACCGCCACCCCTGCCACGACTGTTTGGAGACCTATAGCT
TTCTTCCTCCTCCAGCCCGTCGGGATCCTCGTCCAAAAAACCCTCGTCTGGCTAGTCCAGTACTTGGTCCCCAGG
CCGCCGAGGGTTGTAGCCAGGACCGCGAATCTGCTCTTCGCCTTGGCCTGGTTACACCTGACGGCCGACTTTTTC
GTCGATGATTTTGCTTGCGGAGGGGTGACGCTGCTAGAACTAATTCCCTTTTCCCCCCTGCGCTGGCTGGCTTAC
GGACATGCAACTGGCCACTGGTGGCGCTGGAACCGCCAAATGCTCCCCAGCTGGCACTCTGGGAAGTATTGGTGG
ATGTCTGGTATCGCCATATAG
Transcript >Hirsu2|9355
ATGGACAGAGCGTGGGACAGCGCGCGCGCCGCTCGCCGCGCCGACTTCGCCCAGGCCGTGGCCGACGGCCGACTC
ACGCCCTTTCTCGTCCTCCACAGCCTCCTCGTCTCCATGATCGTGCCCACCCTGTGGCTCAGCATCCCCCACGTG
CGCCGCCCGCGCCTCTACCAGACGCGCTGGCTCGTCGTCGCCTTCGTCGCCGCCTGCAACCTCCACCTCATCTGG
ACGTCGTCCAGCGCCAACGTATTCTCCGCTTACTTCATGGGCGTGTTTATCTCCTCCGGCATTCTTGTAACCATG
AACCTGCTTGTTTGGAGGCGGCCCCAGTTCGACGCGGCAAGGGCCGTCCGGGCTCTGGCTCCTTTGAAACGACCG
CCCCCGGACCAGATGGCCGGCAGCACCCCATACGACCCTCGCCCTTCTCCAAACAGGGACGGGACGCCGGGGCAC
GAGGACCGCGACGCCGCCTCCTTCCGGTCGTGGCGGACAGAGGCCGCCCTGGATGATGGCCTGTTCGTCTGGCAA
CCTTTTCCCGCTGACGCGCCCTTCTCAGACCGCTTCGGATGGGCTTTGGATCTGGTGCTGAGCAATCGAGGCTCA
GGTTGGAACTCGTCCATATCGTCTATCCCGCACCCTCCAGTGGATCTTCCTGTCGGCCCGGGTCAGCCCGTGCGC
CTCCGATCCATGCCCCGTGTGACAAGAAGCGGATACGAACGGTGCTTCACTGAGGGCGAATTCGTGCGGAAGCGG
CTCCTTGAGGTGCTGGCCAAGTATCTGGTCCTTGATTGCTGCCACGTCGCCATGACCAAGGATCCCTACTTCGTC
CTTGGGGCCGACCATGCCCATCGACACCCATCCCATTTACTTGCCTTGCCGGCCTGGCAGCTGCATCTTTACAGG
CAGCTCATATTCCTCCTTTTCATCACGTCACTTCTTCGAATTGTCAGCGCCATCAACGACCTTGTCCAATACTGG
GTCTTCAAGATCTACTTTTCCAGCCGGGCCGCACTCTGGTTATACCCCTCATATTTTGGCTCCTTTTCCCGCGTC
CTCGATGCCGGTCTCGCCGGCTGGTGGGGGGGGTGGTGGCACCAAACCCTCCGACAGCCCTTCTCCGCCCCAGCG
ACGTATCTCCGCACACACGGTTACATCAAGGCCGGCAGCTCCCTGGCGGCCGCCGTCACCATCTTCGTGTCCTTC
CTTCAGTCCGGGCTGGTGCATGCCGCCGCGAGCATGACCGCCACCCCTGCCACGACTGTTTGGAGACCTATAGCT
TTCTTCCTCCTCCAGCCCGTCGGGATCCTCGTCCAAAAAACCCTCGTCTGGCTAGTCCAGTACTTGGTCCCCAGG
CCGCCGAGGGTTGTAGCCAGGACCGCGAATCTGCTCTTCGCCTTGGCCTGGTTACACCTGACGGCCGACTTTTTC
GTCGATGATTTTGCTTGCGGAGGGGTGACGCTGCTAGAACTAATTCCCTTTTCCCCCCTGCGCTGGCTGGCTTAC
GGACATGCAACTGGCCACTGGTGGCGCTGGAACCGCCAAATGCTCCCCAGCTGGCACTCTGGGAAGTATTGGTGG
ATGTCTGGTATCGCCATATAG
Gene >Hirsu2|9355
ATGGACAGAGCGTGGGACAGCGCGCGCGCCGCTCGCCGCGCCGACTTCGCCCAGGCCGTGGCCGACGGCCGACTC
ACGCCCTTTCTCGTCCTCCACAGCCTCCTCGTCTCCATGATCGTGCCCACCCTGTGGCTCAGCATCCCCCACGTG
CGCCGCCCGCGCCTCTACCAGACGCGCTGGCTCGTCGTCGCCTTCGTCGCCGCCTGCAACCTCCACCTCATCTGG
ACGTCGTCCAGCGCCAACGTATTCTCCGCTTACTTCATGGGCGTGTTTATCTCCTCCGGCATTCTTGTAACCATG
AACCTGCTTGTTTGGAGGCGGCCCCAGTTCGACGCGGCAAGGGCCGTCCGGGCTCTGGCTCCTTTGAAACGACCG
CCCCCGGACCAGATGGCCGGCAGCACCCCATACGACCCTCGCCCTTCTCCAAACAGGGACGGGACGCCGGGGCAC
GAGGACCGCGACGCCGCCTCCTTCCGGTCGTGGCGGACAGAGGCCGCCCTGGATGATGGCCTGTTCGTCTGGCAA
CCTTTTCCCGCTGACGCGCCCTTCTCAGACCGCTTCGGATGGGCTTTGGATCTGGTGCTGAGCAATCGAGGCTCA
GGTACGCCCCCTCCCGCTACCGATGCAGTTGTCCACTCCGCCTCCTAACCGCAGCGACAGGTTGGAACTCGTCCA
TATCGTCTATCCCGCACCCTCCAGTGGATCTTCCTGTCGGCCCGGGTCAGCCCGTGCGCCTCCGATCCATGCCCC
GTGTGACAAGAAGCGGATACGAACGGTGCTTCACTGAGGGCGAATTCGTGCGGAAGCGGCTCCTTGAGGTGCTGG
CCAAGTATCTGGTCCTTGATTGCTGCCACGTCGCCATGACCAAGGATCCCTACTTCGTCCTTGGGGCCGACCATG
CCCATCGACACCCATCCCATTTACTTGCCTTGCCGGCCTGGCAGCTGCATCTTTACAGGCAGCTCATATTCCTCC
TTTTCATCACGTCACTTCTTCGAATTGTCAGCGCCATCAACGACCTTGTCCAATACTGGGTCTTCAAGATCTACT
TTTCCAGCCGGGCCGCACTCTGGTTATACCCCTCATATTTTGGCTCCTTTTCCCGCGTCCTCGATGCCGGTCTCG
CCGGCTGGTGGGGGGGGTGGTGGCACCAAACCCTCCGACAGCCCTTCTCCGCCCCAGCGACGTATCTCCGCACAC
ACGGTTACATCAAGGCCGGCAGCTCCCTGGCGGCCGCCGTCACCATCTTCGTGTCCTTCCTTCAGTCCGGGCTGG
TGCATGCCGCCGCGAGCATGACCGCCACCCCTGCCACGACTGTTTGGAGACCTATAGCTTTCTTCCTCCTCCAGC
CCGTCGGGATCCTCGTCCAAAAAACCCTCGTCTGGCTAGTCCAGTACTTGGTCCCCAGGCCGCCGAGGGTTGTAG
CCAGGACCGCGAATCTGCTCTTCGCCTTGGCCTGGTTACACCTGACGGCCGACTTTTTCGTCGATGATTTTGCTT
GCGGAGGGGTGACGCTGCTAGAACTAATTCCCTTTTCCCCCCTGCGCTGGCTGGCTTACGGACATGCAACTGGCC
ACTGGTGGCGCTGGAACCGCCAAATGCTCCCCAGCTGGCACTCTGGGAAGTATTGGTGGATGTCTGGTATCGCCA
TATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail