Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9346
Gene name
LocationContig_673:115..2914
Strand-
Gene length (bp)2799
Transcript length (bp)2799
Coding sequence length (bp)2799
Protein length (aa) 933

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04408 HA2 Helicase associated domain (HA2) 1.9E-22 625 709
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 5.9E-19 768 844
PF00271 Helicase_C Helicase conserved C-terminal domain 5.0E-13 434 560
PF00270 DEAD DEAD/DEAH box helicase 4.9E-07 238 389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 6 900 0.0E+00
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 6 860 0.0E+00
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 6 860 0.0E+00
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 6 894 0.0E+00
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 13 914 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 6 900 0.0E+00
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 6 860 0.0E+00
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 6 860 0.0E+00
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 6 894 0.0E+00
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 13 914 0.0E+00
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 3 850 0.0E+00
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 67 874 0.0E+00
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 67 874 0.0E+00
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 62 860 0.0E+00
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 74 849 0.0E+00
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 60 870 0.0E+00
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 111 860 0.0E+00
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 223 859 0.0E+00
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 221 889 0.0E+00
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 195 859 0.0E+00
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 224 851 0.0E+00
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 220 851 0.0E+00
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 220 851 0.0E+00
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 222 851 0.0E+00
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 211 880 0.0E+00
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 220 851 0.0E+00
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 188 869 0.0E+00
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 216 847 0.0E+00
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 206 869 0.0E+00
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 178 851 0.0E+00
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 224 863 0.0E+00
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 190 849 0.0E+00
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 223 849 0.0E+00
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 224 849 0.0E+00
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 224 849 0.0E+00
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 224 849 0.0E+00
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 211 851 0.0E+00
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 223 847 0.0E+00
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 223 856 0.0E+00
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 223 842 2.0E-175
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 223 855 3.0E-174
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 230 842 1.0E-173
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 227 839 4.0E-173
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 222 847 6.0E-173
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 192 839 7.0E-173
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 221 859 7.0E-172
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 230 869 2.0E-170
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 230 869 3.0E-170
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 230 869 3.0E-169
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 230 869 5.0E-169
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 227 839 9.0E-148
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 324 764 2.0E-141
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 219 842 2.0E-131
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 229 843 8.0E-129
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 224 843 8.0E-120
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 230 839 1.0E-116
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 218 752 2.0E-110
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 218 752 8.0E-109
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 224 847 9.0E-105
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 224 847 2.0E-101
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 213 835 6.0E-101
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 226 844 6.0E-96
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 181 847 7.0E-96
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 213 835 4.0E-94
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 224 847 3.0E-92
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 174 847 1.0E-90
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 224 847 1.0E-84
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 226 792 7.0E-78
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 174 738 7.0E-76
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 174 738 7.0E-76
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 174 738 8.0E-75
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 174 738 1.0E-74
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 226 836 3.0E-74
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 207 679 3.0E-74
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 198 844 4.0E-74
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 174 738 2.0E-73
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 206 836 3.0E-68
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 180 749 3.0E-68
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 222 836 9.0E-68
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 228 807 1.0E-67
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 157 743 2.0E-67
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 227 719 1.0E-66
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 206 836 6.0E-64
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 206 836 7.0E-64
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 229 758 1.0E-63
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 227 778 2.0E-63
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 227 717 7.0E-63
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 229 743 1.0E-62
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 229 738 5.0E-62
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 230 661 2.0E-61
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 229 743 5.0E-61
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 229 738 5.0E-61
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 229 758 5.0E-61
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 231 717 9.0E-61
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 222 836 1.0E-60
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 220 844 7.0E-60
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 226 778 5.0E-59
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 229 778 2.0E-58
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 231 719 1.0E-55
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 230 730 1.0E-55
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 231 760 1.0E-55
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 440 844 2.0E-55
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 231 719 2.0E-55
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 217 452 3.0E-55
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 229 778 2.0E-54
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 224 461 3.0E-53
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 467 843 4.0E-53
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 420 844 5.0E-53
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 420 844 5.0E-53
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 220 471 7.0E-53
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 469 839 2.0E-52
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 436 844 3.0E-51
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 439 844 2.0E-50
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 219 456 5.0E-50
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 371 843 1.0E-49
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 220 462 2.0E-48
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 176 426 2.0E-47
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 472 842 3.0E-47
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 222 414 1.0E-45
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 420 844 2.0E-45
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 464 852 4.0E-45
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 220 748 1.0E-44
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 423 782 3.0E-44
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 228 426 4.0E-44
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 414 836 5.0E-43
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 431 844 8.0E-43
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 440 782 1.0E-42
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 440 844 5.0E-42
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 414 836 6.0E-42
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 191 410 3.0E-41
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 179 414 3.0E-41
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 179 414 3.0E-41
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 223 414 4.0E-41
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 423 748 9.0E-41
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 228 410 4.0E-40
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 217 424 5.0E-40
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 208 648 2.0E-39
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 208 648 5.0E-39
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 208 648 1.0E-38
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 208 648 4.0E-38
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 208 648 4.0E-38
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 220 426 7.0E-38
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 472 851 5.0E-37
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 230 686 1.0E-36
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 210 414 6.0E-36
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 222 414 1.0E-34
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 440 756 1.0E-34
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 189 414 5.0E-34
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 226 426 7.0E-34
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 217 414 1.0E-32
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 182 414 2.0E-32
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 440 809 4.0E-32
sp|Q5UR20|YR366_MIMIV Putative ATP-dependent RNA helicase R366 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R366 PE=3 SV=1 246 569 8.0E-30
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 577 836 8.0E-15
sp|Q9Q927|NPH2_RFVKA RNA helicase NPH-II OS=Rabbit fibroma virus (strain Kasza) GN=NPH2 PE=2 SV=1 251 562 2.0E-09
sp|Q9Q8Q2|NPH2_MYXVL RNA helicase NPH-II OS=Myxoma virus (strain Lausanne) GN=NPH2 PE=3 SV=1 250 562 4.0E-09
sp|Q98218|NPH2_MCV1 RNA helicase NPH-II OS=Molluscum contagiosum virus subtype 1 GN=NPH2 PE=3 SV=1 345 602 3.0E-07
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 227 396 5.0E-07
sp|P19712|POLG_CSFVA Genome polyprotein OS=Classical swine fever virus (strain Alfort) PE=1 SV=2 248 566 1.0E-06
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 439 806 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9346
MDEPTDEDAMALDRDWYGGDELGGHAFGDETHNPFASYEISAWESQQQESAKAEKMVGRYDARQEQRRKENDAWE
MNRMLVSGVAQRRAMAADFDDDEATRVHLLVHELRPPFLDGRTIFTKQLEPVPAVRDYQSDMAVFSRKGSKAVKE
ARQQRERQRQARQATTVAGTTLGNIMGAKEDEGDSALPVAAEEDMQKSESKGNKFSEYMKKAEGASDFTKSKSIR
EQRQSLPAFAVRERLLQVIRENQVTIVVGETGSGKTTQLTQFLYEEGFGRNGMIGCTQPRRVAAMSVAKRVAEEM
EVRLGSTVGYAIRFEDCTSKETVIKYLTDGILLRESLNEPDLDRYSCIIMDEAHERALNTDILMGLFKKIFQRRR
DLKLIVTSATMNAKRFSDFFGGAPEFTIPGRTFPVDVMFHRSPVEDYVDQAVQQVLLIHVSMDPGDILVFMTGQE
DIEVTCELVQRRLDALNDPPKLSILPIYSQMPADLQAKIFDRAPPGIRKCIVATNIAETSLTVDGIKYVVDAGYS
KMKVYNPKMGMDTLQITPISQANASQRSGRAGRTGPGKAYRLFTEKAFKEELYLQTIPEIQRTNLSNTVLMLKSL
GVRDLLDFDFMDPPPQDTITTSMFDLWALGALDNLGELTELGRKMSAFPMDPSLAKLLITADEYGCSEEMVTIVS
MLSVPNVFYRPKERQDEADAQREKFWVHESDHLTYLQVYQAWKANGYSDGWCIKHFLHAKSLRRAKEIRGQLLDI
VKMQKMELSSCGMDWDMIRRCICSGYYHQAARHKGSGEYINLRTNVAVQLHPTSALYAGHPPDYVVYHELILTSK
VFVSTVTAVDPHWLADLGGVFYSVKEKGYSARQKRVIETEFNRKVEIEAKMAEDKRQQEERERAEAERATAAKKK
KKAAAAADGKKFVRQGAVVRPVVKRRPFGRGL*
Coding >Hirsu2|9346
ATGGACGAACCGACCGACGAAGATGCCATGGCGCTGGATCGCGACTGGTACGGGGGCGACGAGCTTGGAGGGCAC
GCTTTCGGCGACGAAACTCACAACCCCTTTGCCTCGTACGAAATTTCGGCCTGGGAGAGCCAGCAGCAGGAGTCG
GCCAAGGCCGAGAAGATGGTGGGCCGGTACGACGCCCGGCAGGAGCAGCGGCGGAAGGAGAACGACGCGTGGGAG
ATGAACAGGATGCTGGTCTCTGGCGTGGCGCAGCGACGAGCCATGGCCGCCGACTTCGACGACGACGAGGCCACT
CGAGTCCATCTCCTCGTCCACGAACTGCGGCCGCCCTTCCTCGACGGACGCACCATCTTCACCAAACAGCTCGAG
CCCGTGCCCGCCGTCAGGGACTATCAGAGCGACATGGCCGTCTTCAGCAGAAAGGGCAGCAAGGCGGTCAAGGAG
GCACGCCAGCAGCGCGAGCGGCAGCGCCAGGCGCGCCAGGCGACCACCGTCGCCGGCACCACGCTCGGCAACATC
ATGGGGGCCAAGGAGGATGAGGGAGACAGCGCGCTCCCCGTCGCCGCCGAGGAGGACATGCAAAAATCCGAGAGC
AAAGGCAACAAGTTCAGCGAGTACATGAAGAAGGCAGAAGGCGCCAGCGACTTCACCAAGAGCAAATCGATACGG
GAGCAGCGGCAGTCCCTGCCGGCCTTTGCCGTCCGAGAGAGGCTGCTGCAGGTGATCCGCGAGAACCAGGTAACC
ATTGTCGTGGGCGAAACGGGCTCGGGCAAGACGACGCAGCTCACACAGTTTCTTTACGAAGAAGGCTTCGGACGG
AACGGCATGATCGGCTGCACACAGCCGCGCCGCGTGGCGGCCATGAGCGTGGCCAAGCGCGTCGCCGAGGAAATG
GAGGTGAGGCTGGGCAGCACTGTCGGCTATGCCATTCGCTTCGAAGACTGCACCAGCAAGGAGACGGTCATTAAG
TACCTGACAGACGGTATCCTGCTCCGAGAGTCACTCAACGAGCCCGACCTCGATCGATATTCCTGCATCATTATG
GACGAGGCCCACGAGCGCGCGCTTAATACCGACATCTTAATGGGGCTATTTAAAAAGATCTTTCAGAGGAGGCGG
GATCTTAAGCTCATCGTTACGTCGGCCACGATGAATGCGAAGCGGTTTTCTGACTTCTTCGGCGGGGCGCCCGAG
TTTACCATCCCGGGGCGGACTTTTCCGGTCGACGTCATGTTCCATCGGTCGCCGGTCGAGGACTACGTCGACCAG
GCAGTCCAGCAGGTGCTTCTCATCCACGTTTCCATGGATCCCGGCGACATTCTCGTCTTCATGACGGGCCAGGAG
GACATCGAGGTCACATGCGAGCTGGTCCAGAGACGACTCGATGCCCTCAACGACCCGCCGAAGCTGAGCATCCTT
CCGATTTACAGCCAGATGCCGGCCGATCTCCAGGCCAAGATCTTCGACCGGGCCCCGCCGGGTATCCGAAAGTGC
ATCGTCGCCACCAACATCGCGGAGACGAGCTTGACGGTGGACGGTATCAAGTACGTGGTGGATGCGGGCTATTCC
AAGATGAAGGTATATAACCCTAAGATGGGCATGGACACGCTCCAGATCACGCCCATCTCCCAGGCGAACGCCTCG
CAGCGATCGGGTCGTGCCGGCCGGACGGGGCCAGGCAAGGCCTATCGGCTCTTCACCGAGAAGGCCTTTAAGGAG
GAGCTGTACCTGCAGACGATACCCGAGATCCAGAGGACAAATTTATCTAATACGGTCTTGATGCTTAAGTCGCTC
GGGGTCAGGGACCTGCTAGACTTTGACTTTATGGACCCGCCGCCGCAGGACACGATCACGACGTCCATGTTCGAC
CTCTGGGCGCTAGGGGCGCTGGACAACCTAGGCGAGCTGACGGAGCTGGGGCGGAAGATGAGCGCGTTCCCGATG
GACCCGTCGCTAGCCAAGCTGCTCATCACGGCGGACGAGTACGGGTGCAGTGAGGAGATGGTGACGATCGTATCG
ATGCTGTCGGTCCCTAACGTCTTCTACAGGCCCAAGGAGCGGCAGGACGAGGCGGACGCGCAGCGGGAGAAGTTC
TGGGTGCACGAGTCGGACCACCTGACGTACCTGCAGGTATACCAGGCGTGGAAGGCCAACGGGTACTCGGACGGG
TGGTGCATCAAGCACTTCCTGCACGCCAAGTCGCTGCGGCGGGCCAAGGAGATCCGGGGACAGCTGCTGGACATT
GTGAAGATGCAGAAGATGGAGCTCAGCAGCTGCGGGATGGACTGGGACATGATCCGCCGCTGCATCTGCTCGGGC
TACTACCACCAGGCGGCCCGGCACAAGGGCTCGGGCGAGTACATCAACCTGCGGACCAACGTGGCGGTGCAGCTG
CACCCGACGAGTGCGCTCTACGCGGGCCACCCGCCCGACTACGTGGTGTACCACGAGCTGATCCTGACGTCCAAG
GTGTTCGTGTCGACGGTCACGGCCGTGGACCCGCACTGGCTGGCCGACCTGGGCGGCGTCTTCTACTCGGTCAAG
GAGAAGGGGTACTCGGCGCGGCAGAAGCGGGTGATCGAGACCGAGTTCAACCGCAAGGTCGAGATTGAGGCCAAG
ATGGCCGAGGACAAGCGGCAGCAGGAGGAGCGGGAGCGGGCCGAGGCGGAGCGGGCGACGGCGGCCAAGAAGAAG
AAGAAGGCGGCGGCGGCGGCGGACGGGAAGAAGTTTGTCAGGCAGGGGGCGGTCGTCAGGCCGGTCGTCAAGAGA
AGGCCGTTTGGCCGAGGGCTCTAG
Transcript >Hirsu2|9346
ATGGACGAACCGACCGACGAAGATGCCATGGCGCTGGATCGCGACTGGTACGGGGGCGACGAGCTTGGAGGGCAC
GCTTTCGGCGACGAAACTCACAACCCCTTTGCCTCGTACGAAATTTCGGCCTGGGAGAGCCAGCAGCAGGAGTCG
GCCAAGGCCGAGAAGATGGTGGGCCGGTACGACGCCCGGCAGGAGCAGCGGCGGAAGGAGAACGACGCGTGGGAG
ATGAACAGGATGCTGGTCTCTGGCGTGGCGCAGCGACGAGCCATGGCCGCCGACTTCGACGACGACGAGGCCACT
CGAGTCCATCTCCTCGTCCACGAACTGCGGCCGCCCTTCCTCGACGGACGCACCATCTTCACCAAACAGCTCGAG
CCCGTGCCCGCCGTCAGGGACTATCAGAGCGACATGGCCGTCTTCAGCAGAAAGGGCAGCAAGGCGGTCAAGGAG
GCACGCCAGCAGCGCGAGCGGCAGCGCCAGGCGCGCCAGGCGACCACCGTCGCCGGCACCACGCTCGGCAACATC
ATGGGGGCCAAGGAGGATGAGGGAGACAGCGCGCTCCCCGTCGCCGCCGAGGAGGACATGCAAAAATCCGAGAGC
AAAGGCAACAAGTTCAGCGAGTACATGAAGAAGGCAGAAGGCGCCAGCGACTTCACCAAGAGCAAATCGATACGG
GAGCAGCGGCAGTCCCTGCCGGCCTTTGCCGTCCGAGAGAGGCTGCTGCAGGTGATCCGCGAGAACCAGGTAACC
ATTGTCGTGGGCGAAACGGGCTCGGGCAAGACGACGCAGCTCACACAGTTTCTTTACGAAGAAGGCTTCGGACGG
AACGGCATGATCGGCTGCACACAGCCGCGCCGCGTGGCGGCCATGAGCGTGGCCAAGCGCGTCGCCGAGGAAATG
GAGGTGAGGCTGGGCAGCACTGTCGGCTATGCCATTCGCTTCGAAGACTGCACCAGCAAGGAGACGGTCATTAAG
TACCTGACAGACGGTATCCTGCTCCGAGAGTCACTCAACGAGCCCGACCTCGATCGATATTCCTGCATCATTATG
GACGAGGCCCACGAGCGCGCGCTTAATACCGACATCTTAATGGGGCTATTTAAAAAGATCTTTCAGAGGAGGCGG
GATCTTAAGCTCATCGTTACGTCGGCCACGATGAATGCGAAGCGGTTTTCTGACTTCTTCGGCGGGGCGCCCGAG
TTTACCATCCCGGGGCGGACTTTTCCGGTCGACGTCATGTTCCATCGGTCGCCGGTCGAGGACTACGTCGACCAG
GCAGTCCAGCAGGTGCTTCTCATCCACGTTTCCATGGATCCCGGCGACATTCTCGTCTTCATGACGGGCCAGGAG
GACATCGAGGTCACATGCGAGCTGGTCCAGAGACGACTCGATGCCCTCAACGACCCGCCGAAGCTGAGCATCCTT
CCGATTTACAGCCAGATGCCGGCCGATCTCCAGGCCAAGATCTTCGACCGGGCCCCGCCGGGTATCCGAAAGTGC
ATCGTCGCCACCAACATCGCGGAGACGAGCTTGACGGTGGACGGTATCAAGTACGTGGTGGATGCGGGCTATTCC
AAGATGAAGGTATATAACCCTAAGATGGGCATGGACACGCTCCAGATCACGCCCATCTCCCAGGCGAACGCCTCG
CAGCGATCGGGTCGTGCCGGCCGGACGGGGCCAGGCAAGGCCTATCGGCTCTTCACCGAGAAGGCCTTTAAGGAG
GAGCTGTACCTGCAGACGATACCCGAGATCCAGAGGACAAATTTATCTAATACGGTCTTGATGCTTAAGTCGCTC
GGGGTCAGGGACCTGCTAGACTTTGACTTTATGGACCCGCCGCCGCAGGACACGATCACGACGTCCATGTTCGAC
CTCTGGGCGCTAGGGGCGCTGGACAACCTAGGCGAGCTGACGGAGCTGGGGCGGAAGATGAGCGCGTTCCCGATG
GACCCGTCGCTAGCCAAGCTGCTCATCACGGCGGACGAGTACGGGTGCAGTGAGGAGATGGTGACGATCGTATCG
ATGCTGTCGGTCCCTAACGTCTTCTACAGGCCCAAGGAGCGGCAGGACGAGGCGGACGCGCAGCGGGAGAAGTTC
TGGGTGCACGAGTCGGACCACCTGACGTACCTGCAGGTATACCAGGCGTGGAAGGCCAACGGGTACTCGGACGGG
TGGTGCATCAAGCACTTCCTGCACGCCAAGTCGCTGCGGCGGGCCAAGGAGATCCGGGGACAGCTGCTGGACATT
GTGAAGATGCAGAAGATGGAGCTCAGCAGCTGCGGGATGGACTGGGACATGATCCGCCGCTGCATCTGCTCGGGC
TACTACCACCAGGCGGCCCGGCACAAGGGCTCGGGCGAGTACATCAACCTGCGGACCAACGTGGCGGTGCAGCTG
CACCCGACGAGTGCGCTCTACGCGGGCCACCCGCCCGACTACGTGGTGTACCACGAGCTGATCCTGACGTCCAAG
GTGTTCGTGTCGACGGTCACGGCCGTGGACCCGCACTGGCTGGCCGACCTGGGCGGCGTCTTCTACTCGGTCAAG
GAGAAGGGGTACTCGGCGCGGCAGAAGCGGGTGATCGAGACCGAGTTCAACCGCAAGGTCGAGATTGAGGCCAAG
ATGGCCGAGGACAAGCGGCAGCAGGAGGAGCGGGAGCGGGCCGAGGCGGAGCGGGCGACGGCGGCCAAGAAGAAG
AAGAAGGCGGCGGCGGCGGCGGACGGGAAGAAGTTTGTCAGGCAGGGGGCGGTCGTCAGGCCGGTCGTCAAGAGA
AGGCCGTTTGGCCGAGGGCTCTAG
Gene >Hirsu2|9346
ATGGACGAACCGACCGACGAAGATGCCATGGCGCTGGATCGCGACTGGTACGGGGGCGACGAGCTTGGAGGGCAC
GCTTTCGGCGACGAAACTCACAACCCCTTTGCCTCGTACGAAATTTCGGCCTGGGAGAGCCAGCAGCAGGAGTCG
GCCAAGGCCGAGAAGATGGTGGGCCGGTACGACGCCCGGCAGGAGCAGCGGCGGAAGGAGAACGACGCGTGGGAG
ATGAACAGGATGCTGGTCTCTGGCGTGGCGCAGCGACGAGCCATGGCCGCCGACTTCGACGACGACGAGGCCACT
CGAGTCCATCTCCTCGTCCACGAACTGCGGCCGCCCTTCCTCGACGGACGCACCATCTTCACCAAACAGCTCGAG
CCCGTGCCCGCCGTCAGGGACTATCAGAGCGACATGGCCGTCTTCAGCAGAAAGGGCAGCAAGGCGGTCAAGGAG
GCACGCCAGCAGCGCGAGCGGCAGCGCCAGGCGCGCCAGGCGACCACCGTCGCCGGCACCACGCTCGGCAACATC
ATGGGGGCCAAGGAGGATGAGGGAGACAGCGCGCTCCCCGTCGCCGCCGAGGAGGACATGCAAAAATCCGAGAGC
AAAGGCAACAAGTTCAGCGAGTACATGAAGAAGGCAGAAGGCGCCAGCGACTTCACCAAGAGCAAATCGATACGG
GAGCAGCGGCAGTCCCTGCCGGCCTTTGCCGTCCGAGAGAGGCTGCTGCAGGTGATCCGCGAGAACCAGGTAACC
ATTGTCGTGGGCGAAACGGGCTCGGGCAAGACGACGCAGCTCACACAGTTTCTTTACGAAGAAGGCTTCGGACGG
AACGGCATGATCGGCTGCACACAGCCGCGCCGCGTGGCGGCCATGAGCGTGGCCAAGCGCGTCGCCGAGGAAATG
GAGGTGAGGCTGGGCAGCACTGTCGGCTATGCCATTCGCTTCGAAGACTGCACCAGCAAGGAGACGGTCATTAAG
TACCTGACAGACGGTATCCTGCTCCGAGAGTCACTCAACGAGCCCGACCTCGATCGATATTCCTGCATCATTATG
GACGAGGCCCACGAGCGCGCGCTTAATACCGACATCTTAATGGGGCTATTTAAAAAGATCTTTCAGAGGAGGCGG
GATCTTAAGCTCATCGTTACGTCGGCCACGATGAATGCGAAGCGGTTTTCTGACTTCTTCGGCGGGGCGCCCGAG
TTTACCATCCCGGGGCGGACTTTTCCGGTCGACGTCATGTTCCATCGGTCGCCGGTCGAGGACTACGTCGACCAG
GCAGTCCAGCAGGTGCTTCTCATCCACGTTTCCATGGATCCCGGCGACATTCTCGTCTTCATGACGGGCCAGGAG
GACATCGAGGTCACATGCGAGCTGGTCCAGAGACGACTCGATGCCCTCAACGACCCGCCGAAGCTGAGCATCCTT
CCGATTTACAGCCAGATGCCGGCCGATCTCCAGGCCAAGATCTTCGACCGGGCCCCGCCGGGTATCCGAAAGTGC
ATCGTCGCCACCAACATCGCGGAGACGAGCTTGACGGTGGACGGTATCAAGTACGTGGTGGATGCGGGCTATTCC
AAGATGAAGGTATATAACCCTAAGATGGGCATGGACACGCTCCAGATCACGCCCATCTCCCAGGCGAACGCCTCG
CAGCGATCGGGTCGTGCCGGCCGGACGGGGCCAGGCAAGGCCTATCGGCTCTTCACCGAGAAGGCCTTTAAGGAG
GAGCTGTACCTGCAGACGATACCCGAGATCCAGAGGACAAATTTATCTAATACGGTCTTGATGCTTAAGTCGCTC
GGGGTCAGGGACCTGCTAGACTTTGACTTTATGGACCCGCCGCCGCAGGACACGATCACGACGTCCATGTTCGAC
CTCTGGGCGCTAGGGGCGCTGGACAACCTAGGCGAGCTGACGGAGCTGGGGCGGAAGATGAGCGCGTTCCCGATG
GACCCGTCGCTAGCCAAGCTGCTCATCACGGCGGACGAGTACGGGTGCAGTGAGGAGATGGTGACGATCGTATCG
ATGCTGTCGGTCCCTAACGTCTTCTACAGGCCCAAGGAGCGGCAGGACGAGGCGGACGCGCAGCGGGAGAAGTTC
TGGGTGCACGAGTCGGACCACCTGACGTACCTGCAGGTATACCAGGCGTGGAAGGCCAACGGGTACTCGGACGGG
TGGTGCATCAAGCACTTCCTGCACGCCAAGTCGCTGCGGCGGGCCAAGGAGATCCGGGGACAGCTGCTGGACATT
GTGAAGATGCAGAAGATGGAGCTCAGCAGCTGCGGGATGGACTGGGACATGATCCGCCGCTGCATCTGCTCGGGC
TACTACCACCAGGCGGCCCGGCACAAGGGCTCGGGCGAGTACATCAACCTGCGGACCAACGTGGCGGTGCAGCTG
CACCCGACGAGTGCGCTCTACGCGGGCCACCCGCCCGACTACGTGGTGTACCACGAGCTGATCCTGACGTCCAAG
GTGTTCGTGTCGACGGTCACGGCCGTGGACCCGCACTGGCTGGCCGACCTGGGCGGCGTCTTCTACTCGGTCAAG
GAGAAGGGGTACTCGGCGCGGCAGAAGCGGGTGATCGAGACCGAGTTCAACCGCAAGGTCGAGATTGAGGCCAAG
ATGGCCGAGGACAAGCGGCAGCAGGAGGAGCGGGAGCGGGCCGAGGCGGAGCGGGCGACGGCGGCCAAGAAGAAG
AAGAAGGCGGCGGCGGCGGCGGACGGGAAGAAGTTTGTCAGGCAGGGGGCGGTCGTCAGGCCGGTCGTCAAGAGA
AGGCCGTTTGGCCGAGGGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail