Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9340
Gene name
LocationContig_671:10545..12672
Strand+
Gene length (bp)2127
Transcript length (bp)1998
Coding sequence length (bp)1998
Protein length (aa) 666

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09531 Ndc1_Nup Nucleoporin protein Ndc1-Nup 2.1E-199 17 612

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S235|NDC1_CHATD Nucleoporin NDC1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NDC1 PE=3 SV=1 7 621 2.0E-161
sp|O13961|NDC1_SCHPO Nuclear envelope protein ndc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut11 PE=2 SV=2 2 604 6.0E-23

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 57 79 22
3 218 240 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9340
MAGTPSRRAPYKDTLQPALHRRFSSTATLLLAVAYLQAVLLATWSSYFWSWFPLGPAGIRTTLIFACGLAILILR
IANYHVGLKTTASGLQVLGSAMLSLQTYETGFWYGFSSLLFCPVFLTSMSDSANLHWITYFSGDRARLNERPLFL
ACYLATCALSQTIQHYRLDVDRLDLGLSKPRPEDREKGSAVLPGSFHAVLVQLPCVLTGCVKQAASTLFLTLVLY
ALFLRSFAWGWALAFLRPFYSLPQTSILPSSWPTDIFLLARCVYAGTLLLFLWSAGNTAFSIFMVKAPLKNGQPL
TSESKDPNGSLLNGLKSKKLSIKSFAMWELALIAKDFEARRRAIYSDIDRKDGPMWAQIYAICMEVLKEVESRAD
DYGKPVASVASEPAAAVTRQRVSAPVREEPILSKTGQASGLVGGIERAWDQIARAPGSSPVSELSPLAKKTWKEA
KDRMLSKEQQQALSADHIKGEFEQHAASLMKMEWAGQLLRQDFRTRFAAAVLGTPYAEPTLYMNAVQALSQLAVH
SLKEDEFGNVHRDVATIVRTMTAVIIKVEALKTRFPDHWTDVSGVRESPEVDALVEALRTGLDQVVVTFQPYSSD
LRLSRGDLRLAKEAAAKPKELLEKPKETAAGETSGKTRGVEEKRKTELGRAQEKVHQRIEMEQVR*
Coding >Hirsu2|9340
ATGGCGGGCACTCCGAGCCGCAGAGCTCCTTATAAGGACACCTTGCAGCCCGCCCTACACCGGCGCTTTTCTTCG
ACCGCCACCCTCCTGCTGGCCGTGGCGTACCTGCAAGCCGTGCTGCTGGCAACCTGGAGCTCTTACTTCTGGTCC
TGGTTTCCGCTCGGCCCTGCTGGCATCCGAACCACGCTCATCTTCGCCTGCGGACTCGCCATCCTAATCTTGCGG
ATAGCCAATTACCATGTCGGTCTCAAGACGACAGCCTCTGGGCTGCAAGTACTCGGCTCCGCCATGCTCAGCCTT
CAGACGTACGAGACCGGCTTTTGGTACGGCTTCTCGAGCCTCCTCTTCTGCCCCGTCTTCCTGACCTCCATGTCG
GACTCGGCAAACCTTCATTGGATTACCTACTTCAGTGGCGACCGCGCCAGACTCAATGAGCGGCCCTTGTTCCTG
GCGTGTTATCTGGCGACGTGCGCGCTATCGCAGACAATCCAACACTACAGGCTCGATGTGGATCGTCTCGACCTC
GGACTGTCAAAGCCGAGACCCGAGGATCGAGAGAAGGGCTCGGCGGTCCTGCCGGGGTCCTTTCACGCCGTTCTC
GTACAACTGCCGTGCGTTCTGACGGGGTGCGTCAAGCAGGCGGCATCAACACTTTTCCTGACTTTGGTCCTCTAC
GCCCTTTTCCTGAGATCTTTTGCATGGGGCTGGGCACTTGCCTTCTTGCGCCCATTCTACAGCCTGCCCCAGACA
AGTATTCTGCCGTCCTCGTGGCCGACTGACATATTCCTCCTTGCTCGATGCGTGTACGCCGGGACGCTTCTTCTT
TTCCTGTGGTCGGCGGGAAATACGGCATTTTCCATCTTCATGGTCAAGGCGCCCCTCAAAAACGGGCAGCCTTTG
ACGTCAGAATCCAAAGACCCCAACGGGAGCCTGCTGAATGGCCTGAAAAGCAAGAAGCTTTCCATCAAGTCATTT
GCCATGTGGGAACTGGCATTGATCGCGAAGGATTTTGAAGCGCGCAGGCGAGCCATCTACAGCGACATTGACCGG
AAAGACGGCCCCATGTGGGCGCAGATCTACGCTATTTGCATGGAGGTGCTAAAGGAGGTCGAATCGCGGGCCGAC
GACTACGGCAAACCGGTTGCGTCCGTCGCTTCCGAGCCGGCAGCAGCGGTGACGAGGCAACGTGTTTCGGCCCCG
GTCCGGGAGGAACCGATTTTGAGCAAGACGGGACAAGCCTCCGGGCTTGTTGGAGGAATCGAGAGGGCCTGGGAT
CAGATTGCTCGGGCTCCCGGCTCCTCTCCGGTCTCAGAGCTGAGTCCACTGGCCAAGAAGACGTGGAAGGAAGCC
AAGGACCGTATGCTTAGCAAGGAGCAGCAGCAGGCTCTGTCTGCCGACCACATCAAGGGCGAATTCGAACAGCAC
GCCGCCAGCCTGATGAAGATGGAGTGGGCTGGACAGCTGCTCCGCCAGGACTTCCGCACCCGGTTCGCAGCTGCA
GTATTGGGCACGCCCTATGCCGAGCCGACGCTCTACATGAATGCGGTCCAGGCGCTCAGTCAGTTGGCTGTGCAT
AGCCTGAAGGAAGACGAGTTTGGCAACGTGCATCGAGACGTGGCGACTATCGTGCGGACGATGACGGCGGTGATC
ATTAAGGTGGAGGCGCTCAAGACGCGGTTCCCCGACCATTGGACAGACGTCTCGGGTGTCAGAGAAAGCCCCGAG
GTGGACGCACTGGTGGAGGCCCTGCGCACCGGGCTGGATCAGGTCGTCGTCACATTTCAGCCGTACAGCAGCGAC
CTGCGGCTTTCCCGCGGCGACCTGCGGCTGGCGAAGGAAGCCGCGGCAAAACCAAAGGAGTTACTGGAAAAGCCG
AAGGAGACGGCGGCCGGGGAGACGAGTGGGAAGACCAGGGGCGTCGAGGAAAAGAGGAAGACGGAGCTGGGAAGG
GCGCAAGAGAAGGTGCATCAACGCATAGAGATGGAGCAGGTTCGGTGA
Transcript >Hirsu2|9340
ATGGCGGGCACTCCGAGCCGCAGAGCTCCTTATAAGGACACCTTGCAGCCCGCCCTACACCGGCGCTTTTCTTCG
ACCGCCACCCTCCTGCTGGCCGTGGCGTACCTGCAAGCCGTGCTGCTGGCAACCTGGAGCTCTTACTTCTGGTCC
TGGTTTCCGCTCGGCCCTGCTGGCATCCGAACCACGCTCATCTTCGCCTGCGGACTCGCCATCCTAATCTTGCGG
ATAGCCAATTACCATGTCGGTCTCAAGACGACAGCCTCTGGGCTGCAAGTACTCGGCTCCGCCATGCTCAGCCTT
CAGACGTACGAGACCGGCTTTTGGTACGGCTTCTCGAGCCTCCTCTTCTGCCCCGTCTTCCTGACCTCCATGTCG
GACTCGGCAAACCTTCATTGGATTACCTACTTCAGTGGCGACCGCGCCAGACTCAATGAGCGGCCCTTGTTCCTG
GCGTGTTATCTGGCGACGTGCGCGCTATCGCAGACAATCCAACACTACAGGCTCGATGTGGATCGTCTCGACCTC
GGACTGTCAAAGCCGAGACCCGAGGATCGAGAGAAGGGCTCGGCGGTCCTGCCGGGGTCCTTTCACGCCGTTCTC
GTACAACTGCCGTGCGTTCTGACGGGGTGCGTCAAGCAGGCGGCATCAACACTTTTCCTGACTTTGGTCCTCTAC
GCCCTTTTCCTGAGATCTTTTGCATGGGGCTGGGCACTTGCCTTCTTGCGCCCATTCTACAGCCTGCCCCAGACA
AGTATTCTGCCGTCCTCGTGGCCGACTGACATATTCCTCCTTGCTCGATGCGTGTACGCCGGGACGCTTCTTCTT
TTCCTGTGGTCGGCGGGAAATACGGCATTTTCCATCTTCATGGTCAAGGCGCCCCTCAAAAACGGGCAGCCTTTG
ACGTCAGAATCCAAAGACCCCAACGGGAGCCTGCTGAATGGCCTGAAAAGCAAGAAGCTTTCCATCAAGTCATTT
GCCATGTGGGAACTGGCATTGATCGCGAAGGATTTTGAAGCGCGCAGGCGAGCCATCTACAGCGACATTGACCGG
AAAGACGGCCCCATGTGGGCGCAGATCTACGCTATTTGCATGGAGGTGCTAAAGGAGGTCGAATCGCGGGCCGAC
GACTACGGCAAACCGGTTGCGTCCGTCGCTTCCGAGCCGGCAGCAGCGGTGACGAGGCAACGTGTTTCGGCCCCG
GTCCGGGAGGAACCGATTTTGAGCAAGACGGGACAAGCCTCCGGGCTTGTTGGAGGAATCGAGAGGGCCTGGGAT
CAGATTGCTCGGGCTCCCGGCTCCTCTCCGGTCTCAGAGCTGAGTCCACTGGCCAAGAAGACGTGGAAGGAAGCC
AAGGACCGTATGCTTAGCAAGGAGCAGCAGCAGGCTCTGTCTGCCGACCACATCAAGGGCGAATTCGAACAGCAC
GCCGCCAGCCTGATGAAGATGGAGTGGGCTGGACAGCTGCTCCGCCAGGACTTCCGCACCCGGTTCGCAGCTGCA
GTATTGGGCACGCCCTATGCCGAGCCGACGCTCTACATGAATGCGGTCCAGGCGCTCAGTCAGTTGGCTGTGCAT
AGCCTGAAGGAAGACGAGTTTGGCAACGTGCATCGAGACGTGGCGACTATCGTGCGGACGATGACGGCGGTGATC
ATTAAGGTGGAGGCGCTCAAGACGCGGTTCCCCGACCATTGGACAGACGTCTCGGGTGTCAGAGAAAGCCCCGAG
GTGGACGCACTGGTGGAGGCCCTGCGCACCGGGCTGGATCAGGTCGTCGTCACATTTCAGCCGTACAGCAGCGAC
CTGCGGCTTTCCCGCGGCGACCTGCGGCTGGCGAAGGAAGCCGCGGCAAAACCAAAGGAGTTACTGGAAAAGCCG
AAGGAGACGGCGGCCGGGGAGACGAGTGGGAAGACCAGGGGCGTCGAGGAAAAGAGGAAGACGGAGCTGGGAAGG
GCGCAAGAGAAGGTGCATCAACGCATAGAGATGGAGCAGGTTCGGTGA
Gene >Hirsu2|9340
ATGGCGGGCACTCCGAGCCGCAGAGCTCCTTATAAGGACACCTTGCAGCCCGCCCTACACCGGCGCTTTTCTTCG
ACCGCCACCCTCCTGCTGGCCGTGGCGTACCTGCAAGCCGTGCTGCTGGCAACCTGGAGCTCTTGTAAGCCCGCG
GCTGTCCTGTCGAGGCGCAGAGTTCGCGCTCGTTTGGCTGATGTTCAACCTTAGACTTCTGGTCCTGGTTTCCGC
TCGGCCCTGCTGGCATCCGAACCACGCTCATCTTCGCCTGCGGACTCGCCATCCTAATCTTGCGGATAGCCAATT
ACCATGTCGGTCTCAAGACGACAGCCTCTGGGCTGCAAGTACTCGGCTCCGCCATGCTCAGCCTTCAGACGTACG
AGACCGGCTTTTGGTACGGCTTCTCGAGCCTCCTCTTCTGCCCCGTCTTCCTGACCTCCATGTCGGACTCGGCAA
ACCTTCATTGGATTACCTACTTCAGTGGCGACCGCGCCAGACTCAATGAGCGGCCCTTGTTCCTGGCGTGTTATC
TGGCGACGTGCGCGCTATCGCAGACAATCCAACACTACAGGCTCGATGTGGATCGTCTCGACCTCGGACTGTCAA
AGCCGAGACCCGAGGATCGAGAGAAGGGCTCGGCGGTCCTGCCGGGGTCCTTTCACGCCGTTCTCGTACAACTGC
CGTGCGTTCTGACGGGGTGCGTCAAGCAGGCGGCATCAACACTTTTCCTGACTTTGGTCCTCTACGCCCTTTTCC
TGAGATCTTTTGCATGGGGCTGGGCACTTGCCTTCTTGCGCCCATTCTACAGCCTGCCCCAGACAAGTATTCTGC
CGTCCTCGTGGCCGACTGACATATTCCTCCTTGCTCGATGCGTGTACGCCGGGACGCTTCTTCTTTTCCTGTGGT
CGGCGGGAAATACGGCATTTTCCATCTTCATGGTCAAGGCGCCCCTCAAAAACGGGCAGCCTTTGACGTCAGAAT
CCAAAGACCCCAACGGGAGCCTGCTGAATGGCCTGAAAAGCAAGAAGCTTTCCATCAAGGTGAGCTCGTCCCGTC
TCGTCACAGGGATGGCGAAGTGAGGCGACCAGCGCTGACTAGTAACAGTCATTTGCCATGTGGGAACTGGCATTG
ATCGCGAAGGATTTTGAAGCGCGCAGGCGAGCCATCTACAGCGACATTGACCGGAAAGACGGCCCCATGTGGGCG
CAGATCTACGCTATTTGCATGGAGGTGCTAAAGGAGGTCGAATCGCGGGCCGACGACTACGGCAAACCGGTTGCG
TCCGTCGCTTCCGAGCCGGCAGCAGCGGTGACGAGGCAACGTGTTTCGGCCCCGGTCCGGGAGGAACCGATTTTG
AGCAAGACGGGACAAGCCTCCGGGCTTGTTGGAGGAATCGAGAGGGCCTGGGATCAGATTGCTCGGGCTCCCGGC
TCCTCTCCGGTCTCAGAGCTGAGTCCACTGGCCAAGAAGACGTGGAAGGAAGCCAAGGACCGTATGCTTAGCAAG
GAGCAGCAGCAGGCTCTGTCTGCCGACCACATCAAGGGCGAATTCGAACAGCACGCCGCCAGCCTGATGAAGATG
GAGTGGGCTGGACAGCTGCTCCGCCAGGACTTCCGCACCCGGTTCGCAGCTGCAGTATTGGGCACGCCCTATGCC
GAGCCGACGCTCTACATGAATGCGGTCCAGGCGCTCAGTCAGTTGGCTGTGCATAGCCTGAAGGAAGACGAGTTT
GGCAACGTGCATCGAGACGTGGCGACTATCGTGCGGACGATGACGGCGGTGATCATTAAGGTGGAGGCGCTCAAG
ACGCGGTTCCCCGACCATTGGACAGACGTCTCGGGTGTCAGAGAAAGCCCCGAGGTGGACGCACTGGTGGAGGCC
CTGCGCACCGGGCTGGATCAGGTCGTCGTCACATTTCAGCCGTACAGCAGCGACCTGCGGCTTTCCCGCGGCGAC
CTGCGGCTGGCGAAGGAAGCCGCGGCAAAACCAAAGGAGTTACTGGAAAAGCCGAAGGAGACGGCGGCCGGGGAG
ACGAGTGGGAAGACCAGGGGCGTCGAGGAAAAGAGGAAGACGGAGCTGGGAAGGGCGCAAGAGAAGGTGCATCAA
CGCATAGAGATGGAGCAGGTTCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail