Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9339
Gene name
LocationContig_671:9337..10204
Strand-
Gene length (bp)867
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14523 Syntaxin_2 Syntaxin-like protein 5.9E-25 32 129
PF05739 SNARE SNARE domain 1.6E-13 212 261

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P93654|SYP22_ARATH Syntaxin-22 OS=Arabidopsis thaliana GN=SYP22 PE=1 SV=1 1 254 3.0E-26
sp|O94651|PEP12_SCHPO Syntaxin pep12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep12 PE=1 SV=2 61 267 3.0E-25
sp|Q39233|SYP21_ARATH Syntaxin-21 OS=Arabidopsis thaliana GN=SYP21 PE=1 SV=1 49 253 2.0E-23
sp|Q5RBW6|STX12_PONAB Syntaxin-12 OS=Pongo abelii GN=STX12 PE=2 SV=1 1 254 5.0E-23
sp|Q86Y82|STX12_HUMAN Syntaxin-12 OS=Homo sapiens GN=STX12 PE=1 SV=1 1 252 8.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P93654|SYP22_ARATH Syntaxin-22 OS=Arabidopsis thaliana GN=SYP22 PE=1 SV=1 1 254 3.0E-26
sp|O94651|PEP12_SCHPO Syntaxin pep12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep12 PE=1 SV=2 61 267 3.0E-25
sp|Q39233|SYP21_ARATH Syntaxin-21 OS=Arabidopsis thaliana GN=SYP21 PE=1 SV=1 49 253 2.0E-23
sp|Q5RBW6|STX12_PONAB Syntaxin-12 OS=Pongo abelii GN=STX12 PE=2 SV=1 1 254 5.0E-23
sp|Q86Y82|STX12_HUMAN Syntaxin-12 OS=Homo sapiens GN=STX12 PE=1 SV=1 1 252 8.0E-22
sp|O70439|STX7_MOUSE Syntaxin-7 OS=Mus musculus GN=Stx7 PE=1 SV=3 31 267 1.0E-21
sp|Q9ER00|STX12_MOUSE Syntaxin-12 OS=Mus musculus GN=Stx12 PE=1 SV=1 1 247 1.0E-20
sp|Q3ZBT5|STX7_BOVIN Syntaxin-7 OS=Bos taurus GN=STX7 PE=2 SV=1 17 247 3.0E-20
sp|G3V7P1|STX12_RAT Syntaxin-12 OS=Rattus norvegicus GN=Stx12 PE=1 SV=1 1 247 4.0E-20
sp|O70257|STX7_RAT Syntaxin-7 OS=Rattus norvegicus GN=Stx7 PE=1 SV=4 17 247 1.0E-19
sp|Q5R602|STX7_PONAB Syntaxin-7 OS=Pongo abelii GN=STX7 PE=2 SV=3 17 247 2.0E-19
sp|O15400|STX7_HUMAN Syntaxin-7 OS=Homo sapiens GN=STX7 PE=1 SV=4 17 243 1.0E-18
sp|Q54JY7|STX7A_DICDI Syntaxin-7A OS=Dictyostelium discoideum GN=syn7A PE=1 SV=1 17 266 1.0E-18
sp|P32854|PEP12_YEAST Syntaxin PEP12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP12 PE=1 SV=2 18 240 1.0E-13
sp|O04378|SYP23_ARATH Syntaxin-23 OS=Arabidopsis thaliana GN=SYP23 PE=1 SV=1 8 228 1.0E-11
sp|Q08144|TLG2_YEAST T-SNARE affecting a late Golgi compartment protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TLG2 PE=1 SV=1 154 264 5.0E-07
sp|Q12241|VAM3_YEAST Syntaxin VAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAM3 PE=1 SV=1 8 245 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 247 266 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9339
MSYDQLSNLESGGRRGGYSDDPAFQDLQYELKSKLQSLLSGNRKLANDVNVLGTKKDTPRLRERVHNSMEKTREL
CREIGDGVKRLQTWDDLSKQQKYEQTKVSSDFQAALQEFQSLQRKALEKEKASVTAARAAHESESGQAGGSAGEP
LDQLQQQQQLPQLASQNEVDFQEALIVEREEEIRNIEQGVGDLNVLFRQVAQIVDEQEVGIRTIADNVENVHDDT
RQADVETRQAARYQKAARNKSCCLLLILAVILTIVILAIVMG*
Coding >Hirsu2|9339
ATGTCGTACGATCAGCTCTCGAACCTCGAGTCGGGCGGCCGCCGCGGCGGCTACAGCGACGATCCCGCGTTCCAA
GATCTCCAGTACGAGCTCAAGTCCAAGCTGCAGTCGCTGCTGAGCGGCAACCGCAAGCTTGCCAACGATGTCAAC
GTCTTGGGGACGAAGAAGGACACGCCTCGTCTGCGCGAGCGAGTGCACAATAGCATGGAGAAGACGCGCGAGCTG
TGCAGGGAGATTGGCGACGGCGTCAAGCGGCTACAGACGTGGGACGATCTCTCGAAGCAGCAAAAGTACGAGCAG
ACCAAGGTGTCCAGCGACTTCCAGGCAGCACTCCAGGAGTTCCAGAGCCTGCAGCGAAAGGCACTCGAGAAGGAA
AAAGCGTCCGTGACGGCCGCGCGCGCCGCCCACGAGTCAGAATCCGGCCAAGCTGGCGGTTCTGCCGGCGAACCG
CTCGACCAGCTACAGCAGCAGCAGCAACTCCCGCAGCTGGCCTCGCAGAATGAGGTCGATTTCCAGGAGGCCCTC
ATTGTCGAACGCGAAGAGGAAATCCGCAACATCGAGCAGGGCGTCGGAGACCTGAACGTCTTGTTTCGGCAGGTA
GCGCAGATCGTCGACGAGCAAGAAGTCGGAATTCGGACCATCGCGGATAACGTGGAGAACGTTCACGACGATACG
CGGCAGGCAGACGTCGAGACGCGGCAGGCAGCGCGGTACCAAAAGGCCGCGCGTAACAAGAGCTGCTGCCTGCTT
CTCATCTTGGCCGTGATCCTCACCATTGTGATTCTGGCCATCGTCATGGGCTGA
Transcript >Hirsu2|9339
ATGTCGTACGATCAGCTCTCGAACCTCGAGTCGGGCGGCCGCCGCGGCGGCTACAGCGACGATCCCGCGTTCCAA
GATCTCCAGTACGAGCTCAAGTCCAAGCTGCAGTCGCTGCTGAGCGGCAACCGCAAGCTTGCCAACGATGTCAAC
GTCTTGGGGACGAAGAAGGACACGCCTCGTCTGCGCGAGCGAGTGCACAATAGCATGGAGAAGACGCGCGAGCTG
TGCAGGGAGATTGGCGACGGCGTCAAGCGGCTACAGACGTGGGACGATCTCTCGAAGCAGCAAAAGTACGAGCAG
ACCAAGGTGTCCAGCGACTTCCAGGCAGCACTCCAGGAGTTCCAGAGCCTGCAGCGAAAGGCACTCGAGAAGGAA
AAAGCGTCCGTGACGGCCGCGCGCGCCGCCCACGAGTCAGAATCCGGCCAAGCTGGCGGTTCTGCCGGCGAACCG
CTCGACCAGCTACAGCAGCAGCAGCAACTCCCGCAGCTGGCCTCGCAGAATGAGGTCGATTTCCAGGAGGCCCTC
ATTGTCGAACGCGAAGAGGAAATCCGCAACATCGAGCAGGGCGTCGGAGACCTGAACGTCTTGTTTCGGCAGGTA
GCGCAGATCGTCGACGAGCAAGAAGTCGGAATTCGGACCATCGCGGATAACGTGGAGAACGTTCACGACGATACG
CGGCAGGCAGACGTCGAGACGCGGCAGGCAGCGCGGTACCAAAAGGCCGCGCGTAACAAGAGCTGCTGCCTGCTT
CTCATCTTGGCCGTGATCCTCACCATTGTGATTCTGGCCATCGTCATGGGCTGA
Gene >Hirsu2|9339
ATGTCGTACGATCAGCTCTCGAACCTCGAGTCGGGCGGCCGCCGCGGCGGCTACAGCGACGATCCCGCGTTCCAA
GATCTCCAGTACGAGCTCAAGTCCAAGCTGCAGTCGCTGCTGAGCGGCAACCGCAAGCTTGCCAACGATGTCAAC
GTCTTGGGGACGAAGAAGGACACGCCTCGTCTGCGCGAGCGAGTGCACAATAGCATGGAGAAGACGCGCGAGCTG
TGCAGGGAGATTGGCGACGGCGTCAAGCGGCTACAGACGTGGGACGATCTCTCGGTCAGTGACCCTTGATGGACT
TCCAGCACCTCCACCTTCTCGGGATACTGACAGTCGGGGCAGAAGCAGCAAAAGTACGAGCAGACCAAGGTGTCC
AGCGACTTCCAGGCAGCACTCCAGGAGTTCCAGAGCCTGCAGCGAAAGGCACTCGAGAAGGAAAAAGCGTCCGTG
ACGGCCGCGCGCGCCGCCCACGAGTCAGAATCCGGCCAAGCTGGCGGTTCTGCCGGCGAACCGCTCGACCAGCTA
CAGCAGCAGCAGCAACTCCCGCAGCTGGCCTCGCAGAATGAGGTCGATTTCCAGGAGGCCCTCATTGTCGAACGC
GAAGAGGAAATCCGCAACATCGAGCAGGGCGTCGGAGACCTGAACGTCTTGTTTCGGCAGGTAGCGCAGATCGTC
GACGAGCAAGAAGTCGGAATTCGGACCATCGCGGATAACGTGGAGAACGTTCACGACGATACGCGGCAGGCAGAC
GTCGAGACGCGGCAGGCAGCGCGGTACCAAAAGGCCGCGCGTAACAAGAGCTGCTGCCTGCTTCTCATCTTGGCC
GTGATCCTCACCATTGTGATTCTGGCCATCGTCATGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail