Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9338
Gene name
LocationContig_671:8188..9169
Strand+
Gene length (bp)981
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R7D0|COX18_PONAB Mitochondrial inner membrane protein COX18 OS=Pongo abelii GN=COX18 PE=2 SV=1 52 298 2.0E-08
sp|B0RMM6|YIDC_XANCB Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain B100) GN=yidC PE=3 SV=1 202 309 1.0E-06
sp|Q3BLZ7|YIDC_XANC5 Membrane protein insertase YidC OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=yidC PE=3 SV=1 202 309 1.0E-06
sp|Q8P338|YIDC_XANCP Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=yidC PE=3 SV=1 202 309 2.0E-06
sp|Q4UNK8|YIDC_XANC8 Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=yidC PE=3 SV=1 202 309 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R7D0|COX18_PONAB Mitochondrial inner membrane protein COX18 OS=Pongo abelii GN=COX18 PE=2 SV=1 52 298 2.0E-08
sp|B0RMM6|YIDC_XANCB Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain B100) GN=yidC PE=3 SV=1 202 309 1.0E-06
sp|Q3BLZ7|YIDC_XANC5 Membrane protein insertase YidC OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=yidC PE=3 SV=1 202 309 1.0E-06
sp|Q8P338|YIDC_XANCP Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=yidC PE=3 SV=1 202 309 2.0E-06
sp|Q4UNK8|YIDC_XANC8 Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=yidC PE=3 SV=1 202 309 2.0E-06
sp|Q8PEH7|YIDC_XANAC Membrane protein insertase YidC OS=Xanthomonas axonopodis pv. citri (strain 306) GN=yidC PE=3 SV=1 202 309 2.0E-06
sp|Q8VC74|COX18_MOUSE Mitochondrial inner membrane protein COX18 OS=Mus musculus GN=Cox18 PE=1 SV=5 52 298 8.0E-06
sp|Q8N8Q8|COX18_HUMAN Mitochondrial inner membrane protein COX18 OS=Homo sapiens GN=COX18 PE=2 SV=1 52 298 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 264 286 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9338
MRLLQTSTKAAWTQPIRAGLPRTPSSARCIGRRQLHLGSLGNEAVALTAGAFGSIHSVGVPWYLTIPLVAVAVNF
SFRLPNQYYARRLVVKRRELSPLVMSWRARHFGRNPAVDIGGTAERLRQLRAAGLVARSARRIYKAWGVQRWKGL
TPLLGLMPFVVVSDALRRLCSAPPTLAGDSSTTLSHTGSLYDPSLAQGGCLWFGDLAAMDPYYALPLLSSAILAA
SVWPKLSKDQFRALFSPNASNQPKPPIERMRDALSRAMIFMPVFPMLFAEMPSAIFLYWATSFGLGILNDSILNR
LVPDRPPKLKPPVLMKTRGMTPFLRG*
Coding >Hirsu2|9338
ATGCGGCTTCTCCAGACATCGACCAAGGCCGCGTGGACGCAACCCATCCGTGCCGGCCTGCCGCGAACACCATCG
TCAGCCCGCTGCATCGGCCGTCGCCAGCTTCACCTGGGCTCCCTCGGCAACGAAGCCGTGGCCCTGACCGCCGGC
GCCTTCGGCTCCATCCACTCGGTCGGTGTGCCGTGGTATCTCACCATCCCCCTCGTCGCCGTGGCCGTCAACTTC
TCCTTCCGGCTTCCCAACCAGTACTATGCTCGCCGGCTGGTCGTGAAGCGGCGTGAGCTGAGCCCGCTGGTGATG
AGCTGGCGGGCACGACACTTCGGGCGCAACCCCGCAGTCGATATCGGCGGCACGGCCGAACGGCTCAGGCAACTG
CGCGCTGCTGGCCTGGTGGCGAGGTCGGCCAGGAGAATCTACAAGGCCTGGGGCGTCCAGAGGTGGAAGGGCCTC
ACGCCTCTCCTGGGCTTGATGCCTTTCGTCGTCGTTTCCGATGCTCTACGCCGCCTCTGCAGTGCACCACCCACC
TTGGCCGGGGACTCTTCTACGACGCTCTCCCACACCGGCAGCCTTTATGATCCGTCTCTTGCCCAAGGAGGCTGT
CTGTGGTTCGGCGACCTGGCCGCGATGGATCCCTACTATGCCCTTCCTCTACTCTCCTCGGCAATCCTTGCGGCC
TCCGTGTGGCCGAAATTATCCAAGGACCAGTTTCGAGCCCTGTTCTCGCCCAACGCAAGCAATCAACCCAAGCCT
CCCATAGAAAGAATGCGGGATGCGCTGTCAAGGGCGATGATTTTTATGCCCGTCTTCCCCATGTTGTTTGCCGAA
ATGCCCAGCGCCATTTTTTTGTATTGGGCTACGTCATTTGGTCTCGGCATACTCAATGATTCGATCTTGAACCGG
CTCGTTCCCGACCGGCCTCCCAAGCTCAAGCCGCCAGTGCTCATGAAGACACGAGGAATGACACCATTTCTGCGA
GGATGA
Transcript >Hirsu2|9338
ATGCGGCTTCTCCAGACATCGACCAAGGCCGCGTGGACGCAACCCATCCGTGCCGGCCTGCCGCGAACACCATCG
TCAGCCCGCTGCATCGGCCGTCGCCAGCTTCACCTGGGCTCCCTCGGCAACGAAGCCGTGGCCCTGACCGCCGGC
GCCTTCGGCTCCATCCACTCGGTCGGTGTGCCGTGGTATCTCACCATCCCCCTCGTCGCCGTGGCCGTCAACTTC
TCCTTCCGGCTTCCCAACCAGTACTATGCTCGCCGGCTGGTCGTGAAGCGGCGTGAGCTGAGCCCGCTGGTGATG
AGCTGGCGGGCACGACACTTCGGGCGCAACCCCGCAGTCGATATCGGCGGCACGGCCGAACGGCTCAGGCAACTG
CGCGCTGCTGGCCTGGTGGCGAGGTCGGCCAGGAGAATCTACAAGGCCTGGGGCGTCCAGAGGTGGAAGGGCCTC
ACGCCTCTCCTGGGCTTGATGCCTTTCGTCGTCGTTTCCGATGCTCTACGCCGCCTCTGCAGTGCACCACCCACC
TTGGCCGGGGACTCTTCTACGACGCTCTCCCACACCGGCAGCCTTTATGATCCGTCTCTTGCCCAAGGAGGCTGT
CTGTGGTTCGGCGACCTGGCCGCGATGGATCCCTACTATGCCCTTCCTCTACTCTCCTCGGCAATCCTTGCGGCC
TCCGTGTGGCCGAAATTATCCAAGGACCAGTTTCGAGCCCTGTTCTCGCCCAACGCAAGCAATCAACCCAAGCCT
CCCATAGAAAGAATGCGGGATGCGCTGTCAAGGGCGATGATTTTTATGCCCGTCTTCCCCATGTTGTTTGCCGAA
ATGCCCAGCGCCATTTTTTTGTATTGGGCTACGTCATTTGGTCTCGGCATACTCAATGATTCGATCTTGAACCGG
CTCGTTCCCGACCGGCCTCCCAAGCTCAAGCCGCCAGTGCTCATGAAGACACGAGGAATGACACCATTTCTGCGA
GGATGA
Gene >Hirsu2|9338
ATGCGGCTTCTCCAGACATCGACCAAGGCCGCGTGGACGCAACCCATCCGTGCCGGCCTGCCGCGAACACCATCG
TCAGCCCGCTGCATCGGCCGTCGCCAGCTTCACCTGGGCTCCCTCGGCAACGAAGCCGTGGCCCTGACCGCCGGC
GCCTTCGGCTCCATCCACTCGGTCGGTGTGCCGTGGTATCTCACCATCCCCCTCGTCGCCGTGGCCGTCAACTTC
TCCTTCCGGCTTCCCAACCAGTACTATGCTCGCCGGCTGGTCGTGAAGCGGCGTGAGCTGAGCCCGCTGGTGATG
AGCTGGCGGGCACGACACTTCGGGCGCAACCCCGCAGTCGATATCGGCGGCACGGCCGAACGGCTCAGGCAACTG
CGCGCTGCTGGCCTGGTGGCGAGGTCGGCCAGGAGAATCTACAAGGCCTGGGGCGTCCAGAGGTGGAAGGGCCTC
ACGCCTCTCCTGGGCTTGATGCCTTTCGTCGTCGTTTCCGATGCTCTACGCCGCCTCTGCAGTGCACCACCCACC
TTGGCCGGGGACTCTTCTACGACGCTCTCCCACACCGGCAGCCTTTATGATCCGTCTCTTGCCCAAGGAGGCTGT
CTGTGGTTCGGCGACCTGGCCGCGATGGATCCCTACTATGCCCTTCCTCTACTCTCCTCGGCAATCCTTGCGGCC
TCCGTGTGGCCGAAATTATCCAAGGACCAGTTTCGAGCCCTGTTCTCGCCCAACGCAAGCAATCAACCCAAGCCT
CCCATAGAAAGAATGCGGGATGCGCTGTCAAGGGCGATGATTTTTATGCCCGTCTTCCCCATGTTGTTTGCCGAA
ATGCCCAGCGCCATTTTTTTGTATTGGGCTACGTCATTTGGTCTCGGCATACTCAATGATTCGATCTTGAACCGG
CTCGTTCCCGACCGGCCTCCCAAGCTCAAGCCGCCAGTGCTCATGAAGACACGAGGAATGACACCATTTCTGCGA
GGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail