Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9337
Gene name
LocationContig_671:5093..6741
Strand-
Gene length (bp)1648
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15924 ALG11_N ALG11 mannosyltransferase N-terminus 3.3E-85 44 252
PF00534 Glycos_transf_1 Glycosyl transferases group 1 5.2E-22 287 445
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 8.6E-13 293 443

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X092|ALG11_NEUCR GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-11 PE=3 SV=1 2 483 0.0E+00
sp|O74878|ALG11_SCHPO GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg11 PE=3 SV=1 45 480 3.0E-139
sp|Q3TZM9|ALG11_MOUSE GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Mus musculus GN=Alg11 PE=2 SV=1 44 481 7.0E-121
sp|Q2TAA5|ALG11_HUMAN GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens GN=ALG11 PE=1 SV=2 44 479 2.0E-119
sp|Q5R7Z6|ALG11_PONAB GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Pongo abelii GN=ALG11 PE=2 SV=2 44 479 8.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X092|ALG11_NEUCR GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-11 PE=3 SV=1 2 483 0.0E+00
sp|O74878|ALG11_SCHPO GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg11 PE=3 SV=1 45 480 3.0E-139
sp|Q3TZM9|ALG11_MOUSE GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Mus musculus GN=Alg11 PE=2 SV=1 44 481 7.0E-121
sp|Q2TAA5|ALG11_HUMAN GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens GN=ALG11 PE=1 SV=2 44 479 2.0E-119
sp|Q5R7Z6|ALG11_PONAB GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Pongo abelii GN=ALG11 PE=2 SV=2 44 479 8.0E-119
sp|Q7ZW24|ALG11_DANRE GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Danio rerio GN=alg11 PE=2 SV=2 36 484 2.0E-118
sp|Q08B22|ALG11_XENLA GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus laevis GN=alg11 PE=2 SV=2 46 474 4.0E-117
sp|Q6P312|ALG11_XENTR GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus tropicalis GN=alg11 PE=2 SV=1 44 474 1.0E-114
sp|Q54DM9|ALG11_DICDI GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Dictyostelium discoideum GN=alg11 PE=3 SV=1 45 480 3.0E-113
sp|Q9XEE9|ALG11_ARATH GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana GN=ALG11 PE=1 SV=2 45 472 1.0E-101
sp|Q6C9T3|ALG11_YARLI GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG11 PE=3 SV=1 44 484 3.0E-96
sp|Q6CLD6|ALG11_KLULA GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG11 PE=3 SV=1 44 472 2.0E-94
sp|Q6FWD1|ALG11_CANGA GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG11 PE=3 SV=1 46 423 7.0E-94
sp|Q75B12|ALG11_ASHGO GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG11 PE=3 SV=1 44 482 2.0E-91
sp|P53993|YMP8_CAEEL Uncharacterized glycosyltransferase B0361.8 OS=Caenorhabditis elegans GN=B0361.8 PE=3 SV=3 45 480 6.0E-91
sp|P53954|ALG11_YEAST GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG11 PE=1 SV=1 44 424 5.0E-82
sp|Q6BVB2|ALG11_DEBHA GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG11 PE=3 SV=2 44 427 2.0E-80
sp|Q59S72|ALG11_CANAL GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG11 PE=3 SV=1 44 463 2.0E-72
sp|Q8X0H8|ALG2_NEUCR Alpha-1,3/1,6-mannosyltransferase alg-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-2 PE=3 SV=1 31 475 7.0E-10
sp|A0LQY9|MSHA_ACIC1 D-inositol 3-phosphate glycosyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=mshA PE=3 SV=1 230 412 2.0E-07
sp|D1A4Q3|MSHA_THECD D-inositol 3-phosphate glycosyltransferase OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=mshA PE=3 SV=1 294 434 3.0E-07
sp|D6Y4U7|MSHA_THEBD D-inositol 3-phosphate glycosyltransferase OS=Thermobispora bispora (strain ATCC 19993 / DSM 43833 / CBS 139.67 / JCM 10125 / NBRC 14880 / R51) GN=mshA PE=3 SV=1 293 465 1.0E-06
sp|Q4JSW2|MSHA_CORJK D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=mshA PE=3 SV=1 291 427 2.0E-06
sp|C8XA09|MSHA_NAKMY D-inositol 3-phosphate glycosyltransferase OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=mshA PE=3 SV=1 235 429 4.0E-06
sp|D0L476|MSHA_GORB4 D-inositol 3-phosphate glycosyltransferase OS=Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / JCM 3198 / NCTC 10667) GN=mshA PE=3 SV=1 292 478 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9337
MNEDSEKFRAQEKKPKSRANEKAQPVLDADARGADKTQQDWDGIVGFFHPFCNAGGGGERVLWAAIRATQSRWPN
AKCVVYTGDHDVNKGDILKRVKGRFNIHLHPPTVQFLYLSKRDWVLATAWPHFTLLGQSLGSVVLAWDAFSLLVP
DIFIDTMGYAFALGLCKVLFPDIPTGAYVHYPTISTDMLDSLDPSSSVGSQGVNAGQGTGMRGMAKKAYWQLFAR
LYSWVGSSVDIVMTNSSWTQAHIDSLWGPYRRRKHADNPIAVVYPPVAVRELEQEVEVSQDSEKTREKVLVYIAQ
FRPEKNHQLVLRSFAEFIRAGSRASEDARLVLIGSVRDDVDSRKVYQLRLLANELGIKDQVEFHLDASWPEILEW
LRKASVGVNGMWNEHFGIGVVEYQAAGLISVVHDSGGPKLDIVIEVDGEPTGYHAATTQEFAASYDQALSLLDPL
AVRKRARTSALRFTEEEFANKWLAQMSRLVALRR*
Coding >Hirsu2|9337
ATGAATGAAGATAGTGAAAAGTTCAGAGCACAAGAGAAGAAGCCCAAGTCCCGCGCAAACGAGAAGGCTCAGCCC
GTCTTGGACGCAGATGCCCGTGGCGCCGACAAGACGCAACAGGACTGGGACGGCATCGTCGGATTCTTCCACCCC
TTCTGCAATGCTGGTGGCGGCGGCGAGCGTGTGCTTTGGGCGGCCATTCGTGCGACGCAGAGTCGGTGGCCCAAC
GCGAAATGTGTCGTTTATACGGGCGACCATGACGTGAACAAGGGAGACATCTTGAAACGAGTCAAGGGCCGATTC
AACATTCACCTCCATCCACCCACCGTGCAGTTCCTGTACCTGTCCAAGAGGGATTGGGTTCTTGCCACTGCCTGG
CCGCATTTCACCCTCCTGGGCCAGTCCCTGGGCTCTGTGGTTCTGGCCTGGGATGCTTTTTCGCTTCTGGTCCCG
GATATTTTCATCGACACCATGGGTTACGCCTTCGCCCTCGGCCTCTGCAAGGTCCTGTTCCCCGACATACCAACA
GGAGCTTACGTCCACTACCCTACTATCTCGACTGACATGCTCGACTCTCTCGACCCGAGCTCATCCGTGGGATCC
CAAGGCGTCAACGCAGGCCAAGGTACGGGCATGCGAGGCATGGCCAAAAAGGCGTATTGGCAGCTCTTTGCGCGC
CTGTATTCATGGGTCGGCTCCTCCGTCGACATTGTCATGACCAACTCGTCTTGGACGCAGGCGCACATTGATAGT
CTCTGGGGCCCATATCGTCGGCGGAAGCACGCGGACAATCCCATTGCGGTTGTCTACCCTCCCGTTGCCGTCCGG
GAGCTGGAACAGGAGGTGGAGGTGTCGCAAGACAGCGAAAAGACGAGAGAGAAGGTTTTGGTGTACATTGCACAA
TTCCGGCCAGAAAAGAACCACCAGCTCGTCCTGCGTTCCTTTGCCGAGTTTATTAGGGCCGGGAGCCGGGCCTCG
GAAGACGCCCGGCTGGTCCTCATCGGGAGCGTTCGCGACGACGTGGACTCCAGAAAGGTCTACCAGTTGCGGCTT
CTCGCAAACGAACTGGGCATCAAGGATCAAGTCGAATTTCACCTGGATGCGTCCTGGCCCGAGATCCTCGAGTGG
CTCAGGAAGGCTTCCGTCGGCGTCAACGGCATGTGGAACGAGCATTTCGGAATAGGGGTCGTGGAGTACCAGGCC
GCCGGCCTCATCTCGGTCGTCCACGACAGCGGCGGGCCCAAGCTCGATATCGTCATCGAGGTAGATGGCGAACCG
ACCGGCTACCACGCGGCCACAACTCAAGAGTTTGCGGCTAGCTATGATCAAGCGCTGTCCCTATTGGACCCCTTG
GCCGTTCGGAAACGTGCGCGCACATCTGCACTGCGGTTCACCGAGGAGGAGTTCGCCAATAAGTGGCTGGCTCAG
ATGAGTCGACTGGTTGCCCTCAGGAGATAA
Transcript >Hirsu2|9337
ATGAATGAAGATAGTGAAAAGTTCAGAGCACAAGAGAAGAAGCCCAAGTCCCGCGCAAACGAGAAGGCTCAGCCC
GTCTTGGACGCAGATGCCCGTGGCGCCGACAAGACGCAACAGGACTGGGACGGCATCGTCGGATTCTTCCACCCC
TTCTGCAATGCTGGTGGCGGCGGCGAGCGTGTGCTTTGGGCGGCCATTCGTGCGACGCAGAGTCGGTGGCCCAAC
GCGAAATGTGTCGTTTATACGGGCGACCATGACGTGAACAAGGGAGACATCTTGAAACGAGTCAAGGGCCGATTC
AACATTCACCTCCATCCACCCACCGTGCAGTTCCTGTACCTGTCCAAGAGGGATTGGGTTCTTGCCACTGCCTGG
CCGCATTTCACCCTCCTGGGCCAGTCCCTGGGCTCTGTGGTTCTGGCCTGGGATGCTTTTTCGCTTCTGGTCCCG
GATATTTTCATCGACACCATGGGTTACGCCTTCGCCCTCGGCCTCTGCAAGGTCCTGTTCCCCGACATACCAACA
GGAGCTTACGTCCACTACCCTACTATCTCGACTGACATGCTCGACTCTCTCGACCCGAGCTCATCCGTGGGATCC
CAAGGCGTCAACGCAGGCCAAGGTACGGGCATGCGAGGCATGGCCAAAAAGGCGTATTGGCAGCTCTTTGCGCGC
CTGTATTCATGGGTCGGCTCCTCCGTCGACATTGTCATGACCAACTCGTCTTGGACGCAGGCGCACATTGATAGT
CTCTGGGGCCCATATCGTCGGCGGAAGCACGCGGACAATCCCATTGCGGTTGTCTACCCTCCCGTTGCCGTCCGG
GAGCTGGAACAGGAGGTGGAGGTGTCGCAAGACAGCGAAAAGACGAGAGAGAAGGTTTTGGTGTACATTGCACAA
TTCCGGCCAGAAAAGAACCACCAGCTCGTCCTGCGTTCCTTTGCCGAGTTTATTAGGGCCGGGAGCCGGGCCTCG
GAAGACGCCCGGCTGGTCCTCATCGGGAGCGTTCGCGACGACGTGGACTCCAGAAAGGTCTACCAGTTGCGGCTT
CTCGCAAACGAACTGGGCATCAAGGATCAAGTCGAATTTCACCTGGATGCGTCCTGGCCCGAGATCCTCGAGTGG
CTCAGGAAGGCTTCCGTCGGCGTCAACGGCATGTGGAACGAGCATTTCGGAATAGGGGTCGTGGAGTACCAGGCC
GCCGGCCTCATCTCGGTCGTCCACGACAGCGGCGGGCCCAAGCTCGATATCGTCATCGAGGTAGATGGCGAACCG
ACCGGCTACCACGCGGCCACAACTCAAGAGTTTGCGGCTAGCTATGATCAAGCGCTGTCCCTATTGGACCCCTTG
GCCGTTCGGAAACGTGCGCGCACATCTGCACTGCGGTTCACCGAGGAGGAGTTCGCCAATAAGTGGCTGGCTCAG
ATGAGTCGACTGGTTGCCCTCAGGAGATAA
Gene >Hirsu2|9337
ATGAATGAAGATAGTGAAAAGTTCAGAGCACAAGAGAAGAAGCCCAAGTCCCGCGCAAACGAGAAGGCTCAGCCC
GTCTTGGACGCAGATGCCCGTGGCGCCGACAAGACGCAACAGGACTGGGACGGCATCGTCGGATTCTTCCACCCC
TTCTGGTGAGTGGCAGCCTCGCCCTTCGACACTGCATGGAGACCAGCCCAGGCGGACTGGCTGACGCTGCACAGC
AATGCTGGTGGCGGCGGCGAGCGTGTGCTTTGGGCGGCCATTCGTGCGACGCAGAGTCGGTGGCCCAACGCGAAA
TGTGTCGTTTATACGGGCGACCATGACGTGAACAAGGGAGACATCTTGAAACGAGTCAAGGTGAGAGTCATCCGG
CTCCAGTCGTAGCTCACCTGCGTCAAATTCTCACACCCGTGCAGGGCCGATTCAACATTCACCTCCATCCACCCA
CCGTGCAGTTCCTGTACCTGTCCAAGAGGGATTGGGTTCTTGCCACTGCCTGGCCGCATTTCACCCTCCTGGGCC
AGTCCCTGGGCTCTGTGGTTCTGGCCTGGGATGCTTTTTCGCTTCTGGTCCCGGATATTTTCATCGACACCATGG
GTTACGCCTTCGCCCTCGGCCTCTGCAAGGTCCTGTTCCCCGACATACCAACAGGAGCTTACGTCCACTACCCTA
CTATCTCGACTGACATGCTCGACTCTCTCGACCCGAGCTCATCCGTGGGATCCCAAGGCGTCAACGCAGGCCAAG
GTACGGGCATGCGAGGCATGGCCAAAAAGGCGTATTGGCAGCTCTTTGCGCGCCTGTATTCATGGGTCGGCTCCT
CCGTCGACATTGTCATGACCAACTCGTCTTGGACGCAGGCGCACATTGATAGTCTCTGGGGCCCATATCGTCGGC
GGAAGCACGCGGACAATCCCATTGCGGTTGTCTACCCTCCCGTTGCCGTCCGGGAGCTGGAACAGGAGGTGGAGG
TGTCGCAAGACAGCGAAAAGACGAGAGAGAAGGTTTTGGTGTACATTGCACAATTCCGGCCAGAAAAGAACCACC
AGCTCGTCCTGCGTTCCTTTGCCGAGTTTATTAGGGCCGGGAGCCGGGCCTCGGAAGACGCCCGGCTGGTCCTCA
TCGGGAGCGTTCGCGACGACGTGGACTCCAGAAAGGTCTACCAGTTGCGGCTTCTCGCAAACGAACTGGGCATCA
AGGATCAAGTCGAATTTCACCTGGATGCGTCCTGGCCCGAGATCCTCGAGTGGCTCAGGAAGGCTTCCGTCGGCG
TCAACGGCATGTGGAACGAGCATTTCGGAATAGGGGTCGTGGAGTACCAGGCCGCCGGCCTCATCTCGGTCGTCC
ACGACAGCGGCGGGCCCAAGCTCGATATCGTCATCGAGGTAGATGGCGAACCGACCGGTACGTGAATGGGGTCCA
TAGCTGAACTTGTGGAAGATGAACGAAGCTGATGAACTCTGTCCAAGGCTACCACGCGGCCACAACTCAAGAGTT
TGCGGCTAGCTATGATCAAGCGCTGTCCCTATTGGACCCCTTGGCCGTTCGGAAACGTGCGCGCACATCTGCACT
GCGGTTCACCGAGGAGGAGTTCGCCAATAAGTGGCTGGCTCAGATGAGTCGACTGGTTGCCCTCAGGAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail