Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9331
Gene name
LocationContig_670:2813..6826
Strand-
Gene length (bp)4013
Transcript length (bp)3954
Coding sequence length (bp)3954
Protein length (aa) 1318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13476 AAA_23 AAA domain 1.6E-32 6 283
PF02463 SMC_N RecF/RecN/SMC N terminal domain 2.0E-11 4 1286

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTJ8|RAD50_SCHPO DNA repair protein rad50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad50 PE=1 SV=3 1 1313 0.0E+00
sp|P12753|RAD50_YEAST DNA repair protein RAD50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD50 PE=1 SV=1 1 1308 0.0E+00
sp|P70388|RAD50_MOUSE DNA repair protein RAD50 OS=Mus musculus GN=Rad50 PE=1 SV=1 1 1316 1.0E-144
sp|Q9JIL8|RAD50_RAT DNA repair protein RAD50 OS=Rattus norvegicus GN=Rad50 PE=1 SV=1 1 1316 3.0E-144
sp|Q92878|RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens GN=RAD50 PE=1 SV=1 1 1316 7.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTJ8|RAD50_SCHPO DNA repair protein rad50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad50 PE=1 SV=3 1 1313 0.0E+00
sp|P12753|RAD50_YEAST DNA repair protein RAD50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD50 PE=1 SV=1 1 1308 0.0E+00
sp|P70388|RAD50_MOUSE DNA repair protein RAD50 OS=Mus musculus GN=Rad50 PE=1 SV=1 1 1316 1.0E-144
sp|Q9JIL8|RAD50_RAT DNA repair protein RAD50 OS=Rattus norvegicus GN=Rad50 PE=1 SV=1 1 1316 3.0E-144
sp|Q92878|RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens GN=RAD50 PE=1 SV=1 1 1316 7.0E-141
sp|Q9SL02|RAD50_ARATH DNA repair protein RAD50 OS=Arabidopsis thaliana GN=RAD50 PE=1 SV=2 1 1308 6.0E-131
sp|Q9W252|RAD50_DROME DNA repair protein RAD50 OS=Drosophila melanogaster GN=rad50 PE=2 SV=4 1 1310 5.0E-112
sp|Q54CS9|RAD50_DICDI DNA repair protein RAD50 OS=Dictyostelium discoideum GN=rad50 PE=3 SV=1 684 1316 1.0E-64
sp|Q8SRK6|RAD50_ENCCU DNA repair protein RAD50 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RAD50 PE=1 SV=1 1 334 4.0E-57
sp|C6KSQ6|RAD50_PLAF7 Probable DNA repair protein RAD50 OS=Plasmodium falciparum (isolate 3D7) GN=PFF0285c PE=3 SV=1 1057 1301 3.0E-47
sp|O44199|RAD50_CAEEL DNA repair protein rad-50 OS=Caenorhabditis elegans GN=rad-50 PE=2 SV=1 1102 1308 2.0E-39
sp|C6KSQ6|RAD50_PLAF7 Probable DNA repair protein RAD50 OS=Plasmodium falciparum (isolate 3D7) GN=PFF0285c PE=3 SV=1 1 245 6.0E-39
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9331
MSRIDKLSISGVRSFSPAVREAIQFNTPLTLIVGYNGSGKTTIIECLKYATTGELPPNSKGGAFIHDPKLCGEKE
VMAQVKLQFRSINNRQHVATRSLQLTVKKTTRSQKTLDCSLVVVNNGERTTTSTRQAQLDEMIPERLGVSRAILD
SVIFCHQDDSLWPLSEPAALKKRFDEIFEALKYTKAIDNLKVLRKKQVEQLGKLQNDEAHNKANKDRGERAEKRM
TLLQGEIEAARDKCEALSAEMQETQDKIKQKREQANSFLQIVQNLSNKREQLEYRQDAVDELRQTIDELPDDDAA
LEESLAQYEQSMERLRDESERNKSQYNQLQRELSDQRKDLAAKLSERGKHQSDKDKHERQLKSRMEMIREAARAH
SFRGYDGELSDQQVKSFHDKIQKLLDEKKRDLERLQRENSAELDKATAVITDLEGRKAAKTQDRVSAKQRIGAID
KRINVLKNDESRIDVDEGAKAVLDSQLEEIGDRFRRAQQELEKSDCDQQLAEDNDKLRQLESESERLGSELVECT
RLASERAQLDFRKKELADRKRKLETLSNAWNSKLAAALGQDVDLGSLEASFQTVLAQQSKVAQDARKKREQAREK
QQAADFRLRTAKESREKKLQDVARCKREVVAALQVVRDNAVIDDYLEEVESVEQQVEELRNELSLFDALVDYYTK
CKRTLDSKKKCQLCERHFDDGQGASVDRLNKKIEKYLDPKGRADVEKDLKEAVANLESLRAVRPSYDTSERLSKE
MPGIRDECKAIEGECDGLERQLEDLESAVSAQEEKLRDLEGLSKTVMNVSQTVRDIKDSESQVERIVSQQSSGGP
PTRGADEIHELQAGVAEQMRALKGKISKLGNDRQRMRDQINSLELEKSELNTKISRAAGQLEKKKDLQDQIQSLR
EEHGHQREAMQRADAELEALEPSISEARSARDEALRRGRGREQGAAEARDAIAGSAAEMKMLDGEIREYAEGGGP
SRLAQNQRAIEALEEAMGRTEAEMAQVTVRANRLKQETDRGEGKRKNIGDNLHYRRHLRTLEVLRREICELEGRR
ADEDYERLQGEARALENAANRQLAERGAVMGAMRTKDEELGRLLREWELDYRDARHKYREAHIRAETTKAAIDDL
ARCGAAVDKAVMHFHSAKMAEVNRIAAELWQSTYQGTDIDTILIRSDNEPGPSSSSSATGAGRRSYNYRLCMVKQ
DAEMDMRGRCSAGQKVLASIIVRLALAESFGLSCGLIALDEPTTNLDRDNIKSLAASLHAILRARAAQRNLQLIV
ITHDEDFLRHMRCSDFCDSFFRVRRDERQNSVIVRESITKIF*
Coding >Hirsu2|9331
ATGTCGAGGATCGACAAGCTGTCCATCTCGGGCGTGCGCTCCTTCAGCCCCGCCGTCCGCGAGGCCATCCAGTTC
AACACGCCCCTGACGCTCATCGTCGGCTACAATGGCTCCGGCAAGACCACCATCATCGAATGCCTCAAGTACGCC
ACCACGGGCGAGCTGCCCCCCAACAGCAAGGGCGGCGCCTTCATCCACGATCCCAAGCTGTGTGGGGAGAAGGAG
GTCATGGCACAGGTCAAGCTGCAGTTCCGCTCCATCAATAACCGCCAGCACGTCGCCACGAGGAGCCTGCAGTTG
ACCGTCAAGAAGACGACCCGCTCGCAAAAGACGCTCGACTGCTCTCTGGTCGTTGTCAACAACGGCGAACGAACG
ACGACGTCCACCAGGCAGGCCCAGCTGGACGAGATGATCCCGGAGCGCCTCGGCGTATCCCGGGCCATCCTCGAT
TCCGTCATCTTCTGCCACCAGGACGATTCTCTCTGGCCCCTGAGCGAGCCCGCCGCGCTCAAGAAACGATTCGAC
GAAATCTTCGAGGCCCTCAAGTACACAAAGGCCATCGACAACCTCAAAGTCCTCCGCAAAAAGCAGGTCGAGCAG
CTCGGCAAGCTCCAAAACGACGAGGCCCACAACAAGGCCAACAAGGACCGCGGCGAGCGAGCCGAGAAGCGCATG
ACGCTGCTCCAGGGCGAAATCGAGGCGGCCCGCGACAAGTGCGAGGCCCTGTCCGCCGAGATGCAGGAGACGCAG
GACAAGATCAAGCAGAAGCGCGAGCAGGCAAACAGCTTCCTTCAGATCGTGCAGAACCTCAGCAACAAGCGGGAA
CAGCTCGAGTATCGACAGGATGCCGTCGACGAGCTGAGGCAAACCATCGATGAGCTGCCAGACGACGACGCCGCC
CTCGAGGAGTCCCTTGCCCAGTACGAGCAGAGCATGGAACGGCTCCGAGACGAGTCCGAGCGGAACAAATCGCAA
TACAACCAGCTCCAGCGGGAGCTGTCCGATCAGCGCAAGGACCTGGCAGCAAAACTCTCCGAGCGCGGCAAGCAC
CAGTCAGACAAGGACAAGCACGAGCGCCAGCTCAAGTCGCGCATGGAGATGATCCGGGAGGCCGCCCGCGCCCAC
TCCTTCCGGGGCTACGACGGGGAACTGTCGGATCAGCAGGTCAAGTCATTCCACGACAAGATCCAGAAGCTCCTC
GATGAAAAGAAGCGCGATCTGGAACGGCTGCAGAGGGAGAACTCGGCCGAGCTCGACAAGGCCACCGCCGTCATC
ACCGATCTCGAGGGGCGCAAGGCCGCCAAGACGCAGGATCGCGTCTCGGCGAAGCAGCGCATCGGCGCCATCGAC
AAGCGCATCAACGTGCTGAAGAACGACGAGAGCCGCATCGACGTCGACGAAGGCGCCAAGGCCGTCCTCGACAGC
CAGCTGGAGGAGATTGGCGACAGGTTCCGACGGGCCCAGCAGGAGCTGGAAAAGTCGGACTGCGACCAGCAGCTG
GCCGAGGACAACGACAAGCTCCGGCAGCTCGAGAGCGAAAGCGAAAGACTCGGCAGCGAGCTCGTCGAGTGCACC
CGCCTGGCGTCCGAGCGAGCGCAGCTCGACTTCAGGAAGAAGGAACTGGCCGACCGAAAGCGCAAGCTCGAGACG
CTGAGCAACGCCTGGAACTCGAAGCTGGCGGCGGCCCTGGGGCAGGACGTCGACCTCGGCTCTCTCGAGGCCAGC
TTTCAAACCGTCCTGGCGCAGCAAAGCAAGGTCGCGCAGGACGCACGCAAGAAGCGGGAGCAGGCAAGAGAGAAG
CAGCAAGCGGCAGACTTCAGGCTTCGAACCGCCAAGGAGTCTCGGGAGAAGAAGCTGCAGGACGTGGCCAGGTGC
AAGCGCGAGGTCGTGGCGGCGCTCCAAGTCGTTCGAGACAACGCCGTCATCGACGACTATCTGGAAGAGGTCGAG
TCCGTGGAGCAGCAGGTTGAGGAGCTGCGGAACGAGCTGAGCCTGTTCGACGCCCTCGTCGACTACTACACCAAG
TGCAAGCGCACGCTGGATTCGAAGAAGAAGTGCCAGCTCTGCGAGAGGCACTTCGACGACGGCCAGGGCGCGAGC
GTGGACCGCCTGAACAAGAAGATTGAGAAATACCTCGATCCCAAGGGGCGAGCCGACGTGGAGAAGGACCTCAAG
GAGGCAGTGGCCAACCTGGAATCCCTGCGAGCCGTCCGACCGTCGTACGACACGAGCGAGAGGCTATCCAAGGAG
ATGCCCGGCATCCGCGACGAGTGCAAGGCCATCGAGGGCGAGTGCGACGGCCTGGAGCGCCAGCTCGAGGACCTC
GAGTCGGCCGTGTCGGCGCAGGAGGAGAAGCTCCGAGACCTGGAGGGCCTGTCCAAGACGGTCATGAACGTGTCG
CAGACGGTCAGGGACATCAAGGACTCGGAGAGCCAGGTGGAGCGCATCGTGTCGCAGCAGTCGTCGGGGGGGCCG
CCGACACGGGGCGCGGACGAGATCCACGAGCTCCAGGCCGGGGTGGCGGAGCAGATGCGGGCCCTCAAGGGCAAG
ATATCGAAGCTCGGCAACGACAGGCAACGGATGCGGGACCAGATCAACTCGCTGGAGCTGGAGAAGAGCGAGCTC
AACACCAAGATCAGCCGGGCGGCGGGGCAGCTGGAGAAGAAGAAGGACCTGCAGGACCAGATCCAGTCGCTGCGG
GAGGAGCACGGGCACCAGCGGGAGGCTATGCAAAGGGCGGACGCCGAGCTGGAGGCGCTGGAGCCGAGCATCTCG
GAGGCGCGGTCGGCGCGGGACGAGGCGCTGCGGCGCGGACGCGGCAGGGAGCAGGGCGCGGCGGAGGCGCGGGAC
GCGATCGCGGGCTCGGCGGCGGAGATGAAGATGCTGGACGGCGAGATTCGCGAGTACGCCGAGGGCGGCGGGCCG
TCGCGGCTGGCGCAGAACCAGCGGGCTATCGAGGCGCTGGAGGAGGCGATGGGCCGGACGGAGGCGGAGATGGCG
CAGGTGACGGTGCGGGCGAACCGGCTCAAGCAGGAGACGGACCGGGGCGAGGGCAAGCGCAAGAACATCGGCGAC
AACCTGCACTACCGGCGGCACCTGCGGACGCTGGAGGTGCTGCGGCGGGAGATCTGCGAGCTCGAGGGCCGGCGG
GCGGACGAGGACTACGAGCGGCTGCAGGGCGAGGCGCGGGCGCTGGAGAACGCGGCGAACCGGCAGCTGGCGGAG
CGCGGGGCCGTCATGGGCGCGATGCGGACCAAGGACGAGGAGCTGGGCCGGCTGCTTCGCGAGTGGGAGCTGGAC
TACCGCGACGCGCGGCACAAGTACCGCGAGGCGCACATCCGGGCCGAGACGACCAAGGCGGCCATCGACGACCTG
GCGCGCTGCGGCGCCGCCGTCGACAAGGCCGTCATGCACTTCCACAGCGCCAAGATGGCCGAGGTGAACCGGATC
GCGGCCGAGCTGTGGCAGAGCACCTACCAGGGCACCGACATCGACACCATCCTGATCCGGTCCGACAACGAGCCC
GGCCCGTCGTCGTCGTCGTCGGCCACCGGCGCCGGCCGCCGCAGCTACAACTACCGCCTGTGCATGGTCAAGCAG
GACGCCGAGATGGACATGCGCGGCCGCTGCTCGGCCGGCCAGAAGGTGCTGGCCAGCATCATCGTCCGCCTCGCG
CTCGCCGAGTCGTTCGGCCTGAGCTGCGGCCTCATCGCCCTCGACGAGCCGACGACGAACCTGGACCGCGACAAC
ATCAAGAGCCTGGCCGCCAGCCTGCACGCCATCCTGCGCGCCCGCGCCGCCCAGCGCAACCTGCAGCTCATCGTC
ATCACCCACGACGAGGACTTTTTGCGCCACATGCGCTGCAGCGACTTCTGCGACTCCTTCTTCCGCGTCCGTCGC
GACGAGCGCCAGAACAGCGTCATCGTCCGCGAGAGCATCACCAAGATCTTTTGA
Transcript >Hirsu2|9331
ATGTCGAGGATCGACAAGCTGTCCATCTCGGGCGTGCGCTCCTTCAGCCCCGCCGTCCGCGAGGCCATCCAGTTC
AACACGCCCCTGACGCTCATCGTCGGCTACAATGGCTCCGGCAAGACCACCATCATCGAATGCCTCAAGTACGCC
ACCACGGGCGAGCTGCCCCCCAACAGCAAGGGCGGCGCCTTCATCCACGATCCCAAGCTGTGTGGGGAGAAGGAG
GTCATGGCACAGGTCAAGCTGCAGTTCCGCTCCATCAATAACCGCCAGCACGTCGCCACGAGGAGCCTGCAGTTG
ACCGTCAAGAAGACGACCCGCTCGCAAAAGACGCTCGACTGCTCTCTGGTCGTTGTCAACAACGGCGAACGAACG
ACGACGTCCACCAGGCAGGCCCAGCTGGACGAGATGATCCCGGAGCGCCTCGGCGTATCCCGGGCCATCCTCGAT
TCCGTCATCTTCTGCCACCAGGACGATTCTCTCTGGCCCCTGAGCGAGCCCGCCGCGCTCAAGAAACGATTCGAC
GAAATCTTCGAGGCCCTCAAGTACACAAAGGCCATCGACAACCTCAAAGTCCTCCGCAAAAAGCAGGTCGAGCAG
CTCGGCAAGCTCCAAAACGACGAGGCCCACAACAAGGCCAACAAGGACCGCGGCGAGCGAGCCGAGAAGCGCATG
ACGCTGCTCCAGGGCGAAATCGAGGCGGCCCGCGACAAGTGCGAGGCCCTGTCCGCCGAGATGCAGGAGACGCAG
GACAAGATCAAGCAGAAGCGCGAGCAGGCAAACAGCTTCCTTCAGATCGTGCAGAACCTCAGCAACAAGCGGGAA
CAGCTCGAGTATCGACAGGATGCCGTCGACGAGCTGAGGCAAACCATCGATGAGCTGCCAGACGACGACGCCGCC
CTCGAGGAGTCCCTTGCCCAGTACGAGCAGAGCATGGAACGGCTCCGAGACGAGTCCGAGCGGAACAAATCGCAA
TACAACCAGCTCCAGCGGGAGCTGTCCGATCAGCGCAAGGACCTGGCAGCAAAACTCTCCGAGCGCGGCAAGCAC
CAGTCAGACAAGGACAAGCACGAGCGCCAGCTCAAGTCGCGCATGGAGATGATCCGGGAGGCCGCCCGCGCCCAC
TCCTTCCGGGGCTACGACGGGGAACTGTCGGATCAGCAGGTCAAGTCATTCCACGACAAGATCCAGAAGCTCCTC
GATGAAAAGAAGCGCGATCTGGAACGGCTGCAGAGGGAGAACTCGGCCGAGCTCGACAAGGCCACCGCCGTCATC
ACCGATCTCGAGGGGCGCAAGGCCGCCAAGACGCAGGATCGCGTCTCGGCGAAGCAGCGCATCGGCGCCATCGAC
AAGCGCATCAACGTGCTGAAGAACGACGAGAGCCGCATCGACGTCGACGAAGGCGCCAAGGCCGTCCTCGACAGC
CAGCTGGAGGAGATTGGCGACAGGTTCCGACGGGCCCAGCAGGAGCTGGAAAAGTCGGACTGCGACCAGCAGCTG
GCCGAGGACAACGACAAGCTCCGGCAGCTCGAGAGCGAAAGCGAAAGACTCGGCAGCGAGCTCGTCGAGTGCACC
CGCCTGGCGTCCGAGCGAGCGCAGCTCGACTTCAGGAAGAAGGAACTGGCCGACCGAAAGCGCAAGCTCGAGACG
CTGAGCAACGCCTGGAACTCGAAGCTGGCGGCGGCCCTGGGGCAGGACGTCGACCTCGGCTCTCTCGAGGCCAGC
TTTCAAACCGTCCTGGCGCAGCAAAGCAAGGTCGCGCAGGACGCACGCAAGAAGCGGGAGCAGGCAAGAGAGAAG
CAGCAAGCGGCAGACTTCAGGCTTCGAACCGCCAAGGAGTCTCGGGAGAAGAAGCTGCAGGACGTGGCCAGGTGC
AAGCGCGAGGTCGTGGCGGCGCTCCAAGTCGTTCGAGACAACGCCGTCATCGACGACTATCTGGAAGAGGTCGAG
TCCGTGGAGCAGCAGGTTGAGGAGCTGCGGAACGAGCTGAGCCTGTTCGACGCCCTCGTCGACTACTACACCAAG
TGCAAGCGCACGCTGGATTCGAAGAAGAAGTGCCAGCTCTGCGAGAGGCACTTCGACGACGGCCAGGGCGCGAGC
GTGGACCGCCTGAACAAGAAGATTGAGAAATACCTCGATCCCAAGGGGCGAGCCGACGTGGAGAAGGACCTCAAG
GAGGCAGTGGCCAACCTGGAATCCCTGCGAGCCGTCCGACCGTCGTACGACACGAGCGAGAGGCTATCCAAGGAG
ATGCCCGGCATCCGCGACGAGTGCAAGGCCATCGAGGGCGAGTGCGACGGCCTGGAGCGCCAGCTCGAGGACCTC
GAGTCGGCCGTGTCGGCGCAGGAGGAGAAGCTCCGAGACCTGGAGGGCCTGTCCAAGACGGTCATGAACGTGTCG
CAGACGGTCAGGGACATCAAGGACTCGGAGAGCCAGGTGGAGCGCATCGTGTCGCAGCAGTCGTCGGGGGGGCCG
CCGACACGGGGCGCGGACGAGATCCACGAGCTCCAGGCCGGGGTGGCGGAGCAGATGCGGGCCCTCAAGGGCAAG
ATATCGAAGCTCGGCAACGACAGGCAACGGATGCGGGACCAGATCAACTCGCTGGAGCTGGAGAAGAGCGAGCTC
AACACCAAGATCAGCCGGGCGGCGGGGCAGCTGGAGAAGAAGAAGGACCTGCAGGACCAGATCCAGTCGCTGCGG
GAGGAGCACGGGCACCAGCGGGAGGCTATGCAAAGGGCGGACGCCGAGCTGGAGGCGCTGGAGCCGAGCATCTCG
GAGGCGCGGTCGGCGCGGGACGAGGCGCTGCGGCGCGGACGCGGCAGGGAGCAGGGCGCGGCGGAGGCGCGGGAC
GCGATCGCGGGCTCGGCGGCGGAGATGAAGATGCTGGACGGCGAGATTCGCGAGTACGCCGAGGGCGGCGGGCCG
TCGCGGCTGGCGCAGAACCAGCGGGCTATCGAGGCGCTGGAGGAGGCGATGGGCCGGACGGAGGCGGAGATGGCG
CAGGTGACGGTGCGGGCGAACCGGCTCAAGCAGGAGACGGACCGGGGCGAGGGCAAGCGCAAGAACATCGGCGAC
AACCTGCACTACCGGCGGCACCTGCGGACGCTGGAGGTGCTGCGGCGGGAGATCTGCGAGCTCGAGGGCCGGCGG
GCGGACGAGGACTACGAGCGGCTGCAGGGCGAGGCGCGGGCGCTGGAGAACGCGGCGAACCGGCAGCTGGCGGAG
CGCGGGGCCGTCATGGGCGCGATGCGGACCAAGGACGAGGAGCTGGGCCGGCTGCTTCGCGAGTGGGAGCTGGAC
TACCGCGACGCGCGGCACAAGTACCGCGAGGCGCACATCCGGGCCGAGACGACCAAGGCGGCCATCGACGACCTG
GCGCGCTGCGGCGCCGCCGTCGACAAGGCCGTCATGCACTTCCACAGCGCCAAGATGGCCGAGGTGAACCGGATC
GCGGCCGAGCTGTGGCAGAGCACCTACCAGGGCACCGACATCGACACCATCCTGATCCGGTCCGACAACGAGCCC
GGCCCGTCGTCGTCGTCGTCGGCCACCGGCGCCGGCCGCCGCAGCTACAACTACCGCCTGTGCATGGTCAAGCAG
GACGCCGAGATGGACATGCGCGGCCGCTGCTCGGCCGGCCAGAAGGTGCTGGCCAGCATCATCGTCCGCCTCGCG
CTCGCCGAGTCGTTCGGCCTGAGCTGCGGCCTCATCGCCCTCGACGAGCCGACGACGAACCTGGACCGCGACAAC
ATCAAGAGCCTGGCCGCCAGCCTGCACGCCATCCTGCGCGCCCGCGCCGCCCAGCGCAACCTGCAGCTCATCGTC
ATCACCCACGACGAGGACTTTTTGCGCCACATGCGCTGCAGCGACTTCTGCGACTCCTTCTTCCGCGTCCGTCGC
GACGAGCGCCAGAACAGCGTCATCGTCCGCGAGAGCATCACCAAGATCTTTTGA
Gene >Hirsu2|9331
ATGTCGAGGATCGACAAGCTGTCCATCTCGGGCGTGCGCTCCTTCAGCCCCGCCGTCCGCGAGGCCATCCAGTTC
AACACGCCCCTGACGCTCATCGTCGGCTACAATGGCTCCGGCAAGACCACCATCATCGAATGCCTCAAGTACGCC
ACCACGGGCGAGCTGCCCCCCAACAGCAAGGGCGGCGCCTTCATCCACGATCCCAAGGTGCGCGCGCCCTGCCCC
CGCCGAGCCGCCTCCTTGCTAACGGGCGCTGCCGCCGTCAGCTGTGTGGGGAGAAGGAGGTCATGGCACAGGTCA
AGCTGCAGTTCCGCTCCATCAATAACCGCCAGCACGTCGCCACGAGGAGCCTGCAGTTGACCGTCAAGAAGACGA
CCCGCTCGCAAAAGACGCTCGACTGCTCTCTGGTCGTTGTCAACAACGGCGAACGAACGACGACGTCCACCAGGC
AGGCCCAGCTGGACGAGATGATCCCGGAGCGCCTCGGCGTATCCCGGGCCATCCTCGATTCCGTCATCTTCTGCC
ACCAGGACGATTCTCTCTGGCCCCTGAGCGAGCCCGCCGCGCTCAAGAAACGATTCGACGAAATCTTCGAGGCCC
TCAAGTACACAAAGGCCATCGACAACCTCAAAGTCCTCCGCAAAAAGCAGGTCGAGCAGCTCGGCAAGCTCCAAA
ACGACGAGGCCCACAACAAGGCCAACAAGGACCGCGGCGAGCGAGCCGAGAAGCGCATGACGCTGCTCCAGGGCG
AAATCGAGGCGGCCCGCGACAAGTGCGAGGCCCTGTCCGCCGAGATGCAGGAGACGCAGGACAAGATCAAGCAGA
AGCGCGAGCAGGCAAACAGCTTCCTTCAGATCGTGCAGAACCTCAGCAACAAGCGGGAACAGCTCGAGTATCGAC
AGGATGCCGTCGACGAGCTGAGGCAAACCATCGATGAGCTGCCAGACGACGACGCCGCCCTCGAGGAGTCCCTTG
CCCAGTACGAGCAGAGCATGGAACGGCTCCGAGACGAGTCCGAGCGGAACAAATCGCAATACAACCAGCTCCAGC
GGGAGCTGTCCGATCAGCGCAAGGACCTGGCAGCAAAACTCTCCGAGCGCGGCAAGCACCAGTCAGACAAGGACA
AGCACGAGCGCCAGCTCAAGTCGCGCATGGAGATGATCCGGGAGGCCGCCCGCGCCCACTCCTTCCGGGGCTACG
ACGGGGAACTGTCGGATCAGCAGGTCAAGTCATTCCACGACAAGATCCAGAAGCTCCTCGATGAAAAGAAGCGCG
ATCTGGAACGGCTGCAGAGGGAGAACTCGGCCGAGCTCGACAAGGCCACCGCCGTCATCACCGATCTCGAGGGGC
GCAAGGCCGCCAAGACGCAGGATCGCGTCTCGGCGAAGCAGCGCATCGGCGCCATCGACAAGCGCATCAACGTGC
TGAAGAACGACGAGAGCCGCATCGACGTCGACGAAGGCGCCAAGGCCGTCCTCGACAGCCAGCTGGAGGAGATTG
GCGACAGGTTCCGACGGGCCCAGCAGGAGCTGGAAAAGTCGGACTGCGACCAGCAGCTGGCCGAGGACAACGACA
AGCTCCGGCAGCTCGAGAGCGAAAGCGAAAGACTCGGCAGCGAGCTCGTCGAGTGCACCCGCCTGGCGTCCGAGC
GAGCGCAGCTCGACTTCAGGAAGAAGGAACTGGCCGACCGAAAGCGCAAGCTCGAGACGCTGAGCAACGCCTGGA
ACTCGAAGCTGGCGGCGGCCCTGGGGCAGGACGTCGACCTCGGCTCTCTCGAGGCCAGCTTTCAAACCGTCCTGG
CGCAGCAAAGCAAGGTCGCGCAGGACGCACGCAAGAAGCGGGAGCAGGCAAGAGAGAAGCAGCAAGCGGCAGACT
TCAGGCTTCGAACCGCCAAGGAGTCTCGGGAGAAGAAGCTGCAGGACGTGGCCAGGTGCAAGCGCGAGGTCGTGG
CGGCGCTCCAAGTCGTTCGAGACAACGCCGTCATCGACGACTATCTGGAAGAGGTCGAGTCCGTGGAGCAGCAGG
TTGAGGAGCTGCGGAACGAGCTGAGCCTGTTCGACGCCCTCGTCGACTACTACACCAAGTGCAAGCGCACGCTGG
ATTCGAAGAAGAAGTGCCAGCTCTGCGAGAGGCACTTCGACGACGGCCAGGGCGCGAGCGTGGACCGCCTGAACA
AGAAGATTGAGAAATACCTCGATCCCAAGGGGCGAGCCGACGTGGAGAAGGACCTCAAGGAGGCAGTGGCCAACC
TGGAATCCCTGCGAGCCGTCCGACCGTCGTACGACACGAGCGAGAGGCTATCCAAGGAGATGCCCGGCATCCGCG
ACGAGTGCAAGGCCATCGAGGGCGAGTGCGACGGCCTGGAGCGCCAGCTCGAGGACCTCGAGTCGGCCGTGTCGG
CGCAGGAGGAGAAGCTCCGAGACCTGGAGGGCCTGTCCAAGACGGTCATGAACGTGTCGCAGACGGTCAGGGACA
TCAAGGACTCGGAGAGCCAGGTGGAGCGCATCGTGTCGCAGCAGTCGTCGGGGGGGCCGCCGACACGGGGCGCGG
ACGAGATCCACGAGCTCCAGGCCGGGGTGGCGGAGCAGATGCGGGCCCTCAAGGGCAAGATATCGAAGCTCGGCA
ACGACAGGCAACGGATGCGGGACCAGATCAACTCGCTGGAGCTGGAGAAGAGCGAGCTCAACACCAAGATCAGCC
GGGCGGCGGGGCAGCTGGAGAAGAAGAAGGACCTGCAGGACCAGATCCAGTCGCTGCGGGAGGAGCACGGGCACC
AGCGGGAGGCTATGCAAAGGGCGGACGCCGAGCTGGAGGCGCTGGAGCCGAGCATCTCGGAGGCGCGGTCGGCGC
GGGACGAGGCGCTGCGGCGCGGACGCGGCAGGGAGCAGGGCGCGGCGGAGGCGCGGGACGCGATCGCGGGCTCGG
CGGCGGAGATGAAGATGCTGGACGGCGAGATTCGCGAGTACGCCGAGGGCGGCGGGCCGTCGCGGCTGGCGCAGA
ACCAGCGGGCTATCGAGGCGCTGGAGGAGGCGATGGGCCGGACGGAGGCGGAGATGGCGCAGGTGACGGTGCGGG
CGAACCGGCTCAAGCAGGAGACGGACCGGGGCGAGGGCAAGCGCAAGAACATCGGCGACAACCTGCACTACCGGC
GGCACCTGCGGACGCTGGAGGTGCTGCGGCGGGAGATCTGCGAGCTCGAGGGCCGGCGGGCGGACGAGGACTACG
AGCGGCTGCAGGGCGAGGCGCGGGCGCTGGAGAACGCGGCGAACCGGCAGCTGGCGGAGCGCGGGGCCGTCATGG
GCGCGATGCGGACCAAGGACGAGGAGCTGGGCCGGCTGCTTCGCGAGTGGGAGCTGGACTACCGCGACGCGCGGC
ACAAGTACCGCGAGGCGCACATCCGGGCCGAGACGACCAAGGCGGCCATCGACGACCTGGCGCGCTGCGGCGCCG
CCGTCGACAAGGCCGTCATGCACTTCCACAGCGCCAAGATGGCCGAGGTGAACCGGATCGCGGCCGAGCTGTGGC
AGAGCACCTACCAGGGCACCGACATCGACACCATCCTGATCCGGTCCGACAACGAGCCCGGCCCGTCGTCGTCGT
CGTCGGCCACCGGCGCCGGCCGCCGCAGCTACAACTACCGCCTGTGCATGGTCAAGCAGGACGCCGAGATGGACA
TGCGCGGCCGCTGCTCGGCCGGCCAGAAGGTGCTGGCCAGCATCATCGTCCGCCTCGCGCTCGCCGAGTCGTTCG
GCCTGAGCTGCGGCCTCATCGCCCTCGACGAGCCGACGACGAACCTGGACCGCGACAACATCAAGAGCCTGGCCG
CCAGCCTGCACGCCATCCTGCGCGCCCGCGCCGCCCAGCGCAACCTGCAGCTCATCGTCATCACCCACGACGAGG
ACTTTTTGCGCCACATGCGCTGCAGCGACTTCTGCGACTCCTTCTTCCGCGTCCGTCGCGACGAGCGCCAGAACA
GCGTCATCGTCCGCGAGAGCATCACCAAGATCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail