Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9328
Gene name
LocationContig_67:38528..40129
Strand-
Gene length (bp)1601
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03069 FmdA_AmdA Acetamidase/Formamidase family 1.6E-174 13 392

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URY7|FMDA_SCHPO Putative formamidase C869.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.04 PE=3 SV=1 6 412 0.0E+00
sp|Q50228|FMDA_METME Formamidase OS=Methylophilus methylotrophus GN=fmdA PE=1 SV=1 5 399 8.0E-163
sp|Q07838|AMDA_MYCSM Acetamidase OS=Mycobacterium smegmatis GN=amdA PE=1 SV=2 24 371 2.0E-130

GO

GO Term Description Terminal node
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9328
MPGKLRTAQSVSFDVPAAEQPYLHNRWHPDIPSVASVKPGETVKIECLDWTGGQIQNNDSADDVRDADLTRVHYL
TGPFEIEGSEPGDLLVVNITDIQPFDESPWGFTGVFARENGGGFLDRHYPKAAKAIWDFDGIYCSSRHIPGVRFA
GLIHPGILGCAPSAEVLAEWNRREASLISECVHSHPGQVVALAPNETNVHAGSATGALKEKIGREGARTVPGRPE
HGGNVDINNISRGSTTYLPVHVPGAKFSVGDLHFSQGDGEISFCGAIEMAGIITINFGLIKNGMKERAIKSPVFR
PGDVAQLFGPSRYLTFEGFSVDESGKQHFMDATVAYRQACLRAIEYLKQFGYSGEQAYLLLSCAPIKGSIAGIVD
VPNACTTLGLPMDIFDFDISVEAERVKRSLGSCPVSDK*
Coding >Hirsu2|9328
ATGCCCGGAAAGCTCCGTACCGCGCAGTCGGTCTCGTTTGACGTGCCCGCCGCCGAGCAGCCGTACTTGCACAAC
CGCTGGCATCCGGACATCCCGAGCGTCGCGTCCGTCAAGCCGGGAGAGACGGTAAAGATCGAGTGCCTCGACTGG
ACTGGCGGACAGATCCAGAACAACGATAGTGCCGACGACGTTCGCGACGCCGACCTCACCCGAGTCCACTACCTC
ACCGGGCCCTTCGAGATAGAGGGCAGCGAGCCGGGTGATCTGCTCGTCGTCAACATCACCGACATCCAGCCCTTC
GACGAGTCGCCCTGGGGCTTCACCGGCGTCTTCGCGCGCGAGAACGGCGGCGGCTTCCTCGACCGCCATTATCCC
AAGGCCGCCAAGGCCATCTGGGACTTTGACGGCATCTACTGCTCCAGCCGCCACATCCCCGGCGTCCGCTTCGCC
GGGCTGATCCACCCCGGCATTCTGGGCTGCGCTCCGTCGGCCGAGGTCCTGGCCGAATGGAACCGCCGGGAGGCG
AGCCTGATCTCCGAGTGCGTGCATTCGCACCCCGGCCAGGTCGTCGCCCTCGCGCCCAACGAGACCAACGTGCAT
GCCGGCAGCGCGACCGGCGCGCTGAAGGAAAAGATTGGGCGCGAAGGGGCGAGGACCGTTCCGGGACGGCCGGAG
CACGGCGGCAACGTCGACATCAACAACATCTCGCGCGGCTCGACGACGTACCTCCCGGTGCATGTCCCGGGGGCC
AAGTTCTCCGTCGGCGATCTTCACTTCAGCCAGGGCGACGGCGAGATTAGCTTCTGCGGAGCGATCGAGATGGCC
GGCATCATCACCATCAACTTCGGACTCATCAAGAACGGCATGAAGGAGCGTGCGATCAAGAGTCCGGTTTTCAGG
CCGGGCGACGTAGCCCAACTGTTCGGGCCTTCGCGCTACCTGACATTTGAGGGGTTTTCGGTCGATGAGTCGGGC
AAGCAGCACTTCATGGATGCGACTGTCGCCTATCGACAGGCATGTCTTCGCGCGATTGAGTATCTAAAGCAATTT
GGCTATTCTGGCGAGCAAGCCTATCTCCTTCTTTCATGTGCGCCCATCAAGGGGAGCATAGCCGGCATTGTCGAT
GTACCAAACGCCTGCACAACGTTGGGATTGCCGATGGACATTTTCGACTTTGACATCTCGGTCGAGGCCGAAAGA
GTCAAGAGATCGTTGGGGTCCTGCCCCGTGTCCGACAAATGA
Transcript >Hirsu2|9328
ATGCCCGGAAAGCTCCGTACCGCGCAGTCGGTCTCGTTTGACGTGCCCGCCGCCGAGCAGCCGTACTTGCACAAC
CGCTGGCATCCGGACATCCCGAGCGTCGCGTCCGTCAAGCCGGGAGAGACGGTAAAGATCGAGTGCCTCGACTGG
ACTGGCGGACAGATCCAGAACAACGATAGTGCCGACGACGTTCGCGACGCCGACCTCACCCGAGTCCACTACCTC
ACCGGGCCCTTCGAGATAGAGGGCAGCGAGCCGGGTGATCTGCTCGTCGTCAACATCACCGACATCCAGCCCTTC
GACGAGTCGCCCTGGGGCTTCACCGGCGTCTTCGCGCGCGAGAACGGCGGCGGCTTCCTCGACCGCCATTATCCC
AAGGCCGCCAAGGCCATCTGGGACTTTGACGGCATCTACTGCTCCAGCCGCCACATCCCCGGCGTCCGCTTCGCC
GGGCTGATCCACCCCGGCATTCTGGGCTGCGCTCCGTCGGCCGAGGTCCTGGCCGAATGGAACCGCCGGGAGGCG
AGCCTGATCTCCGAGTGCGTGCATTCGCACCCCGGCCAGGTCGTCGCCCTCGCGCCCAACGAGACCAACGTGCAT
GCCGGCAGCGCGACCGGCGCGCTGAAGGAAAAGATTGGGCGCGAAGGGGCGAGGACCGTTCCGGGACGGCCGGAG
CACGGCGGCAACGTCGACATCAACAACATCTCGCGCGGCTCGACGACGTACCTCCCGGTGCATGTCCCGGGGGCC
AAGTTCTCCGTCGGCGATCTTCACTTCAGCCAGGGCGACGGCGAGATTAGCTTCTGCGGAGCGATCGAGATGGCC
GGCATCATCACCATCAACTTCGGACTCATCAAGAACGGCATGAAGGAGCGTGCGATCAAGAGTCCGGTTTTCAGG
CCGGGCGACGTAGCCCAACTGTTCGGGCCTTCGCGCTACCTGACATTTGAGGGGTTTTCGGTCGATGAGTCGGGC
AAGCAGCACTTCATGGATGCGACTGTCGCCTATCGACAGGCATGTCTTCGCGCGATTGAGTATCTAAAGCAATTT
GGCTATTCTGGCGAGCAAGCCTATCTCCTTCTTTCATGTGCGCCCATCAAGGGGAGCATAGCCGGCATTGTCGAT
GTACCAAACGCCTGCACAACGTTGGGATTGCCGATGGACATTTTCGACTTTGACATCTCGGTCGAGGCCGAAAGA
GTCAAGAGATCGTTGGGGTCCTGCCCCGTGTCCGACAAATGA
Gene >Hirsu2|9328
ATGCCCGGAAAGCTCCGTACCGCGCAGTCGGTCTCGTTTGACGTGCCCGCCGCCGAGCAGCCGTACTTGCACAAC
CGCTGGCATCCGGACAGTAGGGCCTCTCGTGGGCGTCGGACCAGGCGACGGAGAGGAGAAGCTGACTGAGGATCA
ACCCAGTCCCGAGCGTCGCGTCCGTCAAGCCGGGAGAGACGGTAAAGATCGAGTGCCTCGACTGGACTGGCGGAC
AGATCCAGAACAACGATAGTGCCGACGACGTTCGCGACGCCGACCTCACCCGAGTCCACTACCTCACCGGGCCCT
TCGAGATAGAGGGCAGCGAGCCGGGTGATCTGCTCGTCGTCAACATCACCGACATCCAGCCCTTCGACGAGTCGC
CCTGGGGCTTCACCGGCGTCTTCGCGCGCGAGAACGGCGGCGGCTTCCTCGACCGCCATTATCCCAAGGCCGCCA
AGGCCATCTGGGACTTTGACGGCATCTACTGCTCCAGCCGCCACATCCCCGGCGTCCGCTTCGCCGGGCTGATCC
ACCCCGGCATTCTGGGCTGCGCTCCGTCGGCCGAGGTCCTGGCCGAATGGAACCGCCGGGAGGCGAGCCTGATCT
CCGAGTGCGTGCATTCGCACCCCGGCCAGGTCGTCGCCCTCGCGCCCAACGAGACCAACGTGCATGCCGGCAGCG
CGACCGGCGCGCTGAAGGAAAAGATTGGGCGCGAAGGGGCGAGGACCGTTCCGGGACGGCCGGAGCACGGCGGCA
ACGTCGACATCAACAACATCTCGCGCGGCTCGACGACGTACCTCCCGGTGCATGTCCCGGGGGCCAAGTTCTCCG
TCGGCGATCTTCACTTCAGCCAGGGCGACGGCGAGATTAGCTTCTGCGGAGCGATCGAGATGGTATGTCCCCCCG
ATTCCCTTACTGCTCATCTCTGCTTGGCACTGGTATCCGGACAGTTGAGGACATTGGGAGGCTGTGGTGCTTGGC
TCGAGAGCTGACCATCGTGACACATTCTACTCGCAGGCCGGCATCATCACCATCAACTTCGGACTCATCAAGAAC
GGCATGAAGGAGCGTGCGATCAAGAGTCCGGTTTTCAGGCCGGGCGACGTAGCCCAACTGTTCGGGCCTTCGCGC
TACCTGACATTTGAGGGGTTTTCGGTCGATGAGTCGGGCAAGCAGCACTTCATGGATGCGACTGTCGCCTATCGA
CAGGCATGTCTTCGCGCGATTGAGTATCTAAAGCAATTTGGTGAGTCCAACTTTTCATTTTGCCGCAGAGCAGAA
ACCTGATCCCATCTCGCAACTCTTGCTCATGTTTTCGCACTTGGCGTGCATCCACCTCGCGGCCGCCACCGGCTT
GCAGAAGAGGTTGTGGAAAGTGGACGAGAAGACTGACCCTCTCGGCTATCGTCGACCCAGGCTATTCTGGCGAGC
AAGCCTATCTCCTTCTTTCATGTGCGCCCATCAAGGGGAGCATAGCCGGCATTGTCGATGTACCAAACGCCTGCA
CAACGTTGGGATTGCCGATGGACATTTTCGACTTTGACATCTCGGTCGAGGCCGAAAGAGTCAAGAGATCGTTGG
GGTCCTGCCCCGTGTCCGACAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail