Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|932
Gene name
LocationContig_1194:5344..8176
Strand+
Gene length (bp)2832
Transcript length (bp)2586
Coding sequence length (bp)2586
Protein length (aa) 862

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.5E-13 460 556
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.0E-06 526 583
PF13637 Ank_4 Ankyrin repeats (many copies) 9.9E-09 528 579
PF03105 SPX SPX domain 1.1E-09 1 37
PF13606 Ank_3 Ankyrin repeat 4.3E-03 528 553
PF00023 Ank Ankyrin repeat 8.2E-04 528 556

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 1 851 5.0E-121
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 1 743 9.0E-101
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 745 851 3.0E-29
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 366 813 3.0E-25
sp|Q9C104|GDE1_SCHPO Glycerophosphodiester phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gde1 PE=1 SV=1 51 576 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 1 851 5.0E-121
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 1 743 9.0E-101
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 745 851 3.0E-29
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 366 813 3.0E-25
sp|Q9C104|GDE1_SCHPO Glycerophosphodiester phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gde1 PE=1 SV=1 51 576 4.0E-20
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 362 579 1.0E-13
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 1 508 2.0E-13
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 460 579 2.0E-13
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 344 590 8.0E-13
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 344 588 9.0E-13
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 341 584 9.0E-13
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 369 579 1.0E-12
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 362 604 1.0E-12
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 369 568 3.0E-12
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 353 592 5.0E-12
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 369 579 5.0E-12
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 344 590 9.0E-12
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 369 588 9.0E-12
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 369 568 1.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 179 579 1.0E-11
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 358 582 2.0E-11
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 358 582 3.0E-11
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 369 568 3.0E-11
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 353 579 4.0E-11
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 361 579 5.0E-11
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 365 602 5.0E-11
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 274 579 5.0E-11
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 369 579 5.0E-11
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 1 167 6.0E-11
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 368 579 8.0E-11
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 400 581 1.0E-10
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 357 579 1.0E-10
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 485 591 1.0E-10
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 1 195 1.0E-10
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 369 579 1.0E-10
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 485 591 1.0E-10
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 366 618 1.0E-10
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 239 579 1.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 372 579 2.0E-10
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 349 579 2.0E-10
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 349 579 2.0E-10
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 369 596 2.0E-10
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 369 608 2.0E-10
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 366 580 2.0E-10
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 369 608 2.0E-10
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 342 579 2.0E-10
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 369 579 2.0E-10
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 366 562 3.0E-10
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 436 579 3.0E-10
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 436 579 3.0E-10
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 342 579 3.0E-10
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 369 591 4.0E-10
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 342 579 4.0E-10
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 460 600 4.0E-10
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 364 567 5.0E-10
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 459 601 5.0E-10
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 366 594 6.0E-10
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 364 567 6.0E-10
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 175 579 7.0E-10
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 362 582 7.0E-10
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 366 581 7.0E-10
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 411 587 8.0E-10
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 366 581 9.0E-10
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 463 591 1.0E-09
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 366 579 1.0E-09
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 298 593 1.0E-09
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 485 591 1.0E-09
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 366 579 1.0E-09
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 366 579 1.0E-09
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 366 618 1.0E-09
sp|Q63369|NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=1 SV=1 410 579 1.0E-09
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 458 601 1.0E-09
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 369 579 2.0E-09
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 369 613 2.0E-09
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 273 579 2.0E-09
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 362 582 2.0E-09
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 366 579 2.0E-09
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 454 608 2.0E-09
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 348 579 2.0E-09
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 298 593 3.0E-09
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 372 562 3.0E-09
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 424 582 3.0E-09
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 463 591 4.0E-09
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 373 582 4.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 372 562 4.0E-09
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 469 588 4.0E-09
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 458 601 4.0E-09
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 368 579 4.0E-09
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 366 551 5.0E-09
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 369 579 6.0E-09
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 417 591 6.0E-09
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 345 582 6.0E-09
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 368 579 6.0E-09
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 370 606 7.0E-09
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 347 579 7.0E-09
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 348 579 8.0E-09
sp|P19838|NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens GN=NFKB1 PE=1 SV=2 410 579 8.0E-09
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 424 582 8.0E-09
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 344 571 9.0E-09
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 345 582 1.0E-08
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 327 593 1.0E-08
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 403 582 1.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 366 606 1.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 362 579 1.0E-08
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 348 579 1.0E-08
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 424 582 1.0E-08
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 348 579 1.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 344 571 2.0E-08
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 327 593 2.0E-08
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 353 579 2.0E-08
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 362 579 2.0E-08
sp|Q9QZ71|XPR1_MUSTR Xenotropic and polytropic retrovirus receptor 1 OS=Mus terricolor GN=Xpr1 PE=1 SV=1 1 165 2.0E-08
sp|Q9Z0U0|XPR1_MOUSE Xenotropic and polytropic retrovirus receptor 1 OS=Mus musculus GN=Xpr1 PE=1 SV=1 1 165 2.0E-08
sp|A7XZ53|XPR1_MUSPA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus pahari GN=Xpr1 PE=1 SV=1 1 165 2.0E-08
sp|A8DZH4|XPR1_DANRE Xenotropic and polytropic retrovirus receptor 1 homolog OS=Danio rerio GN=xpr1 PE=3 SV=1 1 165 2.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 369 579 3.0E-08
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 369 579 3.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 370 592 3.0E-08
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 366 579 3.0E-08
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 424 582 3.0E-08
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 472 596 3.0E-08
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 457 591 3.0E-08
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 457 591 3.0E-08
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 457 591 3.0E-08
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 370 592 4.0E-08
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 341 572 4.0E-08
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 373 588 4.0E-08
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 424 582 4.0E-08
sp|Q9R031|XPR1_MUSMC Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus musculus castaneus GN=Xpr1 PE=2 SV=1 1 165 4.0E-08
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 366 579 4.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 356 571 5.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 362 568 5.0E-08
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 341 572 5.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 362 568 5.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 362 591 5.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 366 588 5.0E-08
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 460 579 5.0E-08
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 424 582 5.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 362 591 6.0E-08
sp|Q9UBH6|XPR1_HUMAN Xenotropic and polytropic retrovirus receptor 1 OS=Homo sapiens GN=XPR1 PE=1 SV=1 1 165 6.0E-08
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 460 579 6.0E-08
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 359 587 6.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 369 588 7.0E-08
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 400 579 7.0E-08
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 400 579 7.0E-08
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 321 581 7.0E-08
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 460 591 8.0E-08
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 424 582 8.0E-08
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 424 582 8.0E-08
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 424 582 8.0E-08
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 357 579 8.0E-08
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 460 579 8.0E-08
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 372 562 9.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 365 579 9.0E-08
sp|Q9R032|XPR1_MUSSP Xenotropic and polytropic retrovirus receptor 1 OS=Mus spretus GN=Xpr1 PE=1 SV=1 1 165 9.0E-08
sp|Q02725|VTC3_YEAST Vacuolar transporter chaperone 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC3 PE=1 SV=1 1 226 9.0E-08
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 424 607 9.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 409 591 1.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 362 582 1.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 409 591 1.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 372 591 1.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 372 591 1.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 369 591 1.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 372 562 1.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 469 579 1.0E-07
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 463 587 1.0E-07
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 463 587 1.0E-07
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 463 587 1.0E-07
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 366 580 1.0E-07
sp|Q6F3J0|NFKB1_CANLF Nuclear factor NF-kappa-B p105 subunit OS=Canis lupus familiaris GN=NFKB1 PE=2 SV=2 410 579 1.0E-07
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 366 586 1.0E-07
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 424 582 1.0E-07
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 460 579 1.0E-07
sp|Q28CY9|XPR1_XENTR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus tropicalis GN=xpr1 PE=2 SV=1 1 165 1.0E-07
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 472 596 1.0E-07
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 424 582 1.0E-07
sp|Q9QZ70|XPR1_CRIGR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Cricetulus griseus GN=XPR1 PE=2 SV=1 1 165 1.0E-07
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 424 582 1.0E-07
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 361 570 1.0E-07
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 424 582 1.0E-07
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 424 582 1.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 369 591 2.0E-07
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 363 591 2.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 356 571 2.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 372 591 2.0E-07
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 365 596 2.0E-07
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 424 582 2.0E-07
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 414 592 2.0E-07
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 369 579 2.0E-07
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 424 582 2.0E-07
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 362 591 2.0E-07
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 413 611 2.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 365 582 2.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 460 579 2.0E-07
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 361 581 2.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 416 579 2.0E-07
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 365 554 2.0E-07
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 370 554 2.0E-07
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 343 569 2.0E-07
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 458 579 2.0E-07
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 372 571 2.0E-07
sp|Q9TU72|XPR1_NEOVI Xenotropic and polytropic retrovirus receptor 1 OS=Neovison vison GN=XPR1 PE=2 SV=1 1 165 2.0E-07
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 460 579 2.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 362 569 3.0E-07
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 466 587 3.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 365 582 3.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 369 579 3.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 461 591 3.0E-07
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 363 592 3.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 460 592 3.0E-07
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 361 591 3.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 460 600 3.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 416 579 3.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 460 600 3.0E-07
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 366 581 3.0E-07
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 371 583 3.0E-07
sp|P25799|NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus GN=Nfkb1 PE=1 SV=2 410 579 3.0E-07
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 458 587 3.0E-07
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 466 587 4.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 369 571 4.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 369 579 4.0E-07
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 366 618 4.0E-07
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 411 579 4.0E-07
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 369 579 4.0E-07
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 366 579 4.0E-07
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 369 579 4.0E-07
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 411 588 4.0E-07
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 455 587 4.0E-07
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 402 588 4.0E-07
sp|Q6EPQ3|SPXM1_ORYSJ SPX domain-containing membrane protein Os02g45520 OS=Oryza sativa subsp. japonica GN=Os02g0678200 PE=2 SV=1 1 244 4.0E-07
sp|A2X8A7|SPXM1_ORYSI SPX domain-containing membrane protein OsI_08463 OS=Oryza sativa subsp. indica GN=OsI_08463 PE=3 SV=2 1 244 4.0E-07
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 424 582 4.0E-07
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 424 626 4.0E-07
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 409 579 4.0E-07
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 455 587 4.0E-07
sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 440 581 4.0E-07
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 369 579 4.0E-07
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 424 582 4.0E-07
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 424 582 4.0E-07
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 327 591 5.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 461 591 5.0E-07
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 372 567 5.0E-07
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 470 582 5.0E-07
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 409 579 5.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 369 579 6.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 369 579 6.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 362 579 6.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 414 591 6.0E-07
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 400 579 6.0E-07
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 424 582 6.0E-07
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 410 579 6.0E-07
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 460 579 6.0E-07
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 460 579 6.0E-07
sp|Q6DD44|XPR1_XENLA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus laevis GN=xpr1 PE=2 SV=1 1 165 6.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 366 579 7.0E-07
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 369 588 7.0E-07
sp|Q5ZMD2|ANKY2_CHICK Ankyrin repeat and MYND domain-containing protein 2 OS=Gallus gallus GN=ANKMY2 PE=2 SV=1 454 579 7.0E-07
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 413 582 7.0E-07
sp|Q9NXR5|ANR10_HUMAN Ankyrin repeat domain-containing protein 10 OS=Homo sapiens GN=ANKRD10 PE=1 SV=2 489 673 7.0E-07
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 460 600 7.0E-07
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 410 579 7.0E-07
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 424 582 7.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 407 551 7.0E-07
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 393 601 7.0E-07
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 411 588 7.0E-07
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 369 619 8.0E-07
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 416 579 8.0E-07
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 424 582 8.0E-07
sp|P50086|PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 343 580 8.0E-07
sp|Q08353|IKBA_PIG NF-kappa-B inhibitor alpha OS=Sus scrofa GN=NFKBIA PE=2 SV=1 413 579 8.0E-07
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 341 579 8.0E-07
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 350 579 9.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 461 591 9.0E-07
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 369 588 9.0E-07
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 460 579 9.0E-07
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 402 588 9.0E-07
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 470 582 9.0E-07
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 363 592 1.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 337 579 1.0E-06
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 362 579 1.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 329 579 1.0E-06
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 460 580 1.0E-06
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 469 581 1.0E-06
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 245 579 1.0E-06
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 418 608 1.0E-06
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 458 579 1.0E-06
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 414 582 1.0E-06
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 368 579 1.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 372 592 2.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 369 579 2.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 365 582 2.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 476 579 2.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 476 579 2.0E-06
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 444 608 2.0E-06
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 471 579 2.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 369 579 2.0E-06
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 460 571 2.0E-06
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 366 579 2.0E-06
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 370 554 2.0E-06
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 366 579 2.0E-06
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 417 579 2.0E-06
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 424 582 2.0E-06
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 424 582 2.0E-06
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 424 582 2.0E-06
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 417 579 2.0E-06
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 405 582 2.0E-06
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 417 579 2.0E-06
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 411 619 2.0E-06
sp|Q658H5|SPXM3_ORYSJ SPX domain-containing membrane protein Os06g0129400 OS=Oryza sativa subsp. japonica GN=Os06g0129400 PE=2 SV=1 1 133 2.0E-06
sp|A2Y8U6|SPXM3_ORYSI SPX domain-containing membrane protein OsI_21475 OS=Oryza sativa subsp. indica GN=OsI_21475 PE=3 SV=1 1 133 2.0E-06
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 463 599 2.0E-06
sp|Q5ZLC6|ANR10_CHICK Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 489 673 2.0E-06
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 369 579 2.0E-06
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 454 608 2.0E-06
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 365 579 2.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 366 562 3.0E-06
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 365 582 3.0E-06
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 334 590 3.0E-06
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 460 571 3.0E-06
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 463 579 3.0E-06
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 410 579 3.0E-06
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 407 587 3.0E-06
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 369 579 3.0E-06
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 445 579 3.0E-06
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 369 718 3.0E-06
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 460 579 3.0E-06
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 417 579 3.0E-06
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 460 579 3.0E-06
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 460 579 3.0E-06
sp|Q99LW0|ANR10_MOUSE Ankyrin repeat domain-containing protein 10 OS=Mus musculus GN=Ankrd10 PE=2 SV=2 449 599 3.0E-06
sp|Q2V4F9|SPXM1_ARATH SPX domain-containing membrane protein At1g63010 OS=Arabidopsis thaliana GN=At1g63010 PE=2 SV=1 3 155 3.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 476 579 4.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 417 581 4.0E-06
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 411 579 4.0E-06
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 366 582 4.0E-06
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 410 579 4.0E-06
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 472 588 4.0E-06
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 415 589 4.0E-06
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 369 579 4.0E-06
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 373 516 4.0E-06
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 465 565 4.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 400 640 4.0E-06
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 460 571 4.0E-06
sp|O00221|IKBE_HUMAN NF-kappa-B inhibitor epsilon OS=Homo sapiens GN=NFKBIE PE=1 SV=3 410 552 4.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 362 579 5.0E-06
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 362 579 5.0E-06
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 366 562 5.0E-06
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 354 577 5.0E-06
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 369 579 5.0E-06
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 342 593 5.0E-06
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 424 579 5.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 366 591 6.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 416 591 6.0E-06
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 366 579 6.0E-06
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 410 599 6.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 362 579 6.0E-06
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 350 579 6.0E-06
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 341 579 6.0E-06
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 424 582 6.0E-06
sp|P25963|IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 413 579 6.0E-06
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 471 584 7.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 434 579 7.0E-06
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 366 562 7.0E-06
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 365 579 7.0E-06
sp|Q0JAW2|SPXM2_ORYSJ SPX domain-containing membrane protein Os04g0573000 OS=Oryza sativa subsp. japonica GN=Os04g0573000 PE=2 SV=2 1 155 7.0E-06
sp|B8AT51|SPXM2_ORYSI SPX domain-containing membrane protein OsI_17046 OS=Oryza sativa subsp. indica GN=OsI_17046 PE=3 SV=1 1 155 7.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 365 582 8.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 459 589 8.0E-06
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 454 579 8.0E-06
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 347 510 8.0E-06
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 471 620 8.0E-06
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 405 582 8.0E-06
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 445 579 8.0E-06
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 471 579 8.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 369 579 9.0E-06
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 358 579 9.0E-06
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 454 583 9.0E-06
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 365 567 9.0E-06
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 476 596 9.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 417 581 1.0E-05
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 460 593 1.0E-05
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 407 579 1.0E-05
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 444 581 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|932
MKFGRNLPRNQVPEWAAFYINYKGLKKLVKSASEKAKNGDAVDPAELFFALDRNLEDVDSFYNKKLAEACRRLNI
LHNRYGRVPDVVATLDQDEVEEVMGALLELRTQLRNLQWFGEINRRGFVKITKKLDKKVPGMSSQLSYISTKVDP
KPFAKDGNTSRLLAEINRWLSVLGDAQNMDDSNSDRSTRSLGRASAKAMLHLPQAQLDALDQAVRSDDVASLRSG
LDDASLGQEAQAQSLLLNLLQRSISARSRACVAFLLPRIKDLDEPDDINGRNCIHRLVIHIGRTKSATPGDDGAS
PHPVSVGAQFINGHLQPAVSSTVPVKSINTSEGERRLDEDDEAVQTLIYLLDQLTPDQRRALKSRDSFGRLPLHY
AAQFGFVVVCQIIMGKMQEWGQFDVQDGIDAPEWQDNDGYAPLHLSVVGGHPLTTRALLQGEERQGSGEDKAQLH
KSIPKSGAVLALATRANYEPIVEMLVQAGVDVNWTDKTGESVLHIAARYGHVGCAHIIVRGSEWHKADLEIAEHS
YSWTPLHVAAVDGSIGVVQLLVEAGADVSRPDASGWTAKEHAALRGHMDIARLLAAHTNEVEAASRVAAGLQAAP
NAPENSSIDERRSNGASSNGGVGVGGVGGGGGGRTAEPVKSFGHRYLTSESLVLVSLGTMDIRKSTDAVHLDRVP
LTEAHNTQLDTALSVVMSANGAAGEPTIIDLPVHEGISTEPVVFTTRDASKVKLLFDIVPTYSGSEKNKIGRAVA
LLSSIKPALGTQRVSLQGDVCVPIVSSQLEVIGTVNFNFLVITPFHHANMEVTSRQTYWKKLSSTMLIGHRGLGK
NLTSNKSLQLGENTLPSFIAAANLGAQRASTRRCTR*
Coding >Hirsu2|932
ATGAAATTCGGACGCAATCTTCCGCGCAACCAGGTCCCCGAGTGGGCGGCCTTCTACATCAACTACAAGGGCCTC
AAGAAACTAGTCAAGAGCGCGTCGGAAAAGGCCAAGAACGGGGACGCCGTCGATCCAGCAGAGCTCTTCTTCGCC
CTCGACCGCAATCTCGAGGACGTCGACTCCTTCTACAACAAGAAGCTCGCCGAGGCCTGCCGCCGCCTCAACATC
CTTCACAACCGCTATGGACGCGTCCCGGACGTCGTCGCCACCCTCGACCAGGACGAGGTCGAGGAGGTCATGGGC
GCCCTGCTGGAGCTCCGGACCCAGCTGCGAAACCTGCAGTGGTTCGGCGAGATCAACCGCAGGGGCTTCGTCAAG
ATCACCAAGAAGCTCGATAAGAAGGTGCCCGGCATGTCGTCCCAGCTGAGCTACATATCGACCAAGGTCGACCCG
AAGCCGTTTGCCAAGGACGGCAACACCAGCAGGCTGCTCGCCGAGATCAACCGCTGGCTCTCCGTCCTGGGCGAC
GCCCAGAACATGGACGACTCCAACTCGGACCGCTCCACCCGCTCCCTCGGCCGGGCCTCGGCCAAGGCCATGCTC
CACCTCCCGCAGGCCCAGCTCGACGCGCTGGACCAGGCCGTCCGTAGCGACGACGTCGCCTCGCTCAGGTCCGGC
CTCGACGACGCCAGCCTCGGTCAGGAGGCGCAGGCCCAGAGCCTGCTGCTCAACCTCCTGCAGCGCTCCATCTCG
GCCCGGTCCAGGGCCTGCGTCGCCTTCCTGCTGCCGCGCATCAAGGACCTGGACGAGCCGGACGACATCAACGGC
CGCAACTGCATCCACCGGCTCGTCATCCACATCGGCCGCACCAAGTCGGCGACGCCCGGCGACGACGGCGCAAGC
CCGCACCCCGTGTCGGTCGGCGCGCAGTTCATCAACGGGCACCTCCAGCCCGCCGTCTCGTCGACGGTGCCCGTC
AAGTCGATCAACACGAGCGAAGGCGAGCGCCGCCTGGACGAGGACGACGAGGCGGTGCAGACGCTCATCTACCTG
CTCGACCAGCTGACGCCGGACCAGCGCCGCGCACTCAAGAGCCGCGACTCCTTCGGCCGGCTGCCCCTCCACTAC
GCCGCCCAGTTCGGCTTCGTCGTCGTCTGCCAGATCATCATGGGCAAGATGCAGGAGTGGGGCCAGTTCGACGTG
CAGGACGGCATCGACGCGCCCGAGTGGCAGGACAACGACGGCTACGCGCCGCTGCACCTCAGCGTCGTCGGCGGC
CACCCGCTCACCACGCGCGCCCTGCTGCAGGGCGAGGAGCGGCAGGGGAGCGGCGAGGACAAGGCGCAGCTGCAC
AAGAGCATCCCCAAGTCGGGGGCGGTCCTCGCGCTGGCGACACGGGCCAACTATGAGCCCATCGTTGAGATGCTG
GTGCAGGCGGGCGTCGACGTCAACTGGACGGACAAGACGGGCGAGTCGGTCCTGCACATCGCCGCCAGGTACGGG
CACGTCGGCTGCGCGCACATCATCGTGCGGGGCAGCGAGTGGCACAAGGCGGACCTGGAGATCGCGGAGCACTCG
TACTCGTGGACGCCGCTGCACGTGGCGGCCGTCGACGGCTCCATCGGCGTCGTGCAGCTGCTGGTGGAGGCGGGC
GCGGACGTGTCGCGGCCGGACGCGTCGGGCTGGACGGCCAAGGAGCACGCGGCACTGCGCGGGCACATGGACATC
GCGCGCCTCCTGGCCGCGCACACCAACGAGGTGGAGGCGGCGTCGAGGGTGGCGGCGGGACTGCAGGCGGCGCCT
AACGCGCCGGAGAACTCGTCGATCGACGAGCGACGGTCGAACGGGGCGAGCTCGAACGGCGGCGTCGGCGTCGGC
GGCGTCGGCGGCGGCGGCGGCGGACGGACGGCGGAGCCGGTCAAGAGCTTCGGCCATCGCTACCTAACGAGCGAG
AGCCTAGTGCTGGTCAGCCTGGGGACGATGGACATTCGCAAGAGCACGGACGCGGTGCACCTGGACCGGGTGCCG
CTGACGGAGGCGCACAACACGCAGCTGGACACGGCGCTGTCGGTGGTGATGAGCGCCAACGGGGCGGCGGGCGAG
CCGACCATCATCGACCTGCCGGTGCACGAGGGCATCTCGACGGAGCCGGTGGTGTTCACGACGCGGGACGCGTCC
AAGGTGAAGCTGCTGTTCGACATCGTGCCGACGTACTCGGGCAGCGAGAAGAACAAGATCGGGCGGGCGGTGGCG
CTGCTGTCGTCGATCAAGCCGGCGCTGGGGACGCAGCGGGTCAGCCTGCAGGGCGACGTGTGCGTGCCGATCGTG
TCGAGCCAGCTGGAGGTGATCGGGACGGTCAACTTCAACTTCCTCGTCATCACGCCCTTCCACCACGCCAACATG
GAGGTGACGTCGCGGCAGACGTACTGGAAGAAGCTGTCGTCGACGATGCTCATCGGGCACCGGGGCCTGGGCAAG
AACCTGACGTCGAACAAGTCGCTGCAGCTGGGGGAGAACACGCTGCCGTCGTTCATCGCGGCGGCCAACCTGGGG
GCGCAACGGGCATCGACGCGCCGGTGCACACGCTGA
Transcript >Hirsu2|932
ATGAAATTCGGACGCAATCTTCCGCGCAACCAGGTCCCCGAGTGGGCGGCCTTCTACATCAACTACAAGGGCCTC
AAGAAACTAGTCAAGAGCGCGTCGGAAAAGGCCAAGAACGGGGACGCCGTCGATCCAGCAGAGCTCTTCTTCGCC
CTCGACCGCAATCTCGAGGACGTCGACTCCTTCTACAACAAGAAGCTCGCCGAGGCCTGCCGCCGCCTCAACATC
CTTCACAACCGCTATGGACGCGTCCCGGACGTCGTCGCCACCCTCGACCAGGACGAGGTCGAGGAGGTCATGGGC
GCCCTGCTGGAGCTCCGGACCCAGCTGCGAAACCTGCAGTGGTTCGGCGAGATCAACCGCAGGGGCTTCGTCAAG
ATCACCAAGAAGCTCGATAAGAAGGTGCCCGGCATGTCGTCCCAGCTGAGCTACATATCGACCAAGGTCGACCCG
AAGCCGTTTGCCAAGGACGGCAACACCAGCAGGCTGCTCGCCGAGATCAACCGCTGGCTCTCCGTCCTGGGCGAC
GCCCAGAACATGGACGACTCCAACTCGGACCGCTCCACCCGCTCCCTCGGCCGGGCCTCGGCCAAGGCCATGCTC
CACCTCCCGCAGGCCCAGCTCGACGCGCTGGACCAGGCCGTCCGTAGCGACGACGTCGCCTCGCTCAGGTCCGGC
CTCGACGACGCCAGCCTCGGTCAGGAGGCGCAGGCCCAGAGCCTGCTGCTCAACCTCCTGCAGCGCTCCATCTCG
GCCCGGTCCAGGGCCTGCGTCGCCTTCCTGCTGCCGCGCATCAAGGACCTGGACGAGCCGGACGACATCAACGGC
CGCAACTGCATCCACCGGCTCGTCATCCACATCGGCCGCACCAAGTCGGCGACGCCCGGCGACGACGGCGCAAGC
CCGCACCCCGTGTCGGTCGGCGCGCAGTTCATCAACGGGCACCTCCAGCCCGCCGTCTCGTCGACGGTGCCCGTC
AAGTCGATCAACACGAGCGAAGGCGAGCGCCGCCTGGACGAGGACGACGAGGCGGTGCAGACGCTCATCTACCTG
CTCGACCAGCTGACGCCGGACCAGCGCCGCGCACTCAAGAGCCGCGACTCCTTCGGCCGGCTGCCCCTCCACTAC
GCCGCCCAGTTCGGCTTCGTCGTCGTCTGCCAGATCATCATGGGCAAGATGCAGGAGTGGGGCCAGTTCGACGTG
CAGGACGGCATCGACGCGCCCGAGTGGCAGGACAACGACGGCTACGCGCCGCTGCACCTCAGCGTCGTCGGCGGC
CACCCGCTCACCACGCGCGCCCTGCTGCAGGGCGAGGAGCGGCAGGGGAGCGGCGAGGACAAGGCGCAGCTGCAC
AAGAGCATCCCCAAGTCGGGGGCGGTCCTCGCGCTGGCGACACGGGCCAACTATGAGCCCATCGTTGAGATGCTG
GTGCAGGCGGGCGTCGACGTCAACTGGACGGACAAGACGGGCGAGTCGGTCCTGCACATCGCCGCCAGGTACGGG
CACGTCGGCTGCGCGCACATCATCGTGCGGGGCAGCGAGTGGCACAAGGCGGACCTGGAGATCGCGGAGCACTCG
TACTCGTGGACGCCGCTGCACGTGGCGGCCGTCGACGGCTCCATCGGCGTCGTGCAGCTGCTGGTGGAGGCGGGC
GCGGACGTGTCGCGGCCGGACGCGTCGGGCTGGACGGCCAAGGAGCACGCGGCACTGCGCGGGCACATGGACATC
GCGCGCCTCCTGGCCGCGCACACCAACGAGGTGGAGGCGGCGTCGAGGGTGGCGGCGGGACTGCAGGCGGCGCCT
AACGCGCCGGAGAACTCGTCGATCGACGAGCGACGGTCGAACGGGGCGAGCTCGAACGGCGGCGTCGGCGTCGGC
GGCGTCGGCGGCGGCGGCGGCGGACGGACGGCGGAGCCGGTCAAGAGCTTCGGCCATCGCTACCTAACGAGCGAG
AGCCTAGTGCTGGTCAGCCTGGGGACGATGGACATTCGCAAGAGCACGGACGCGGTGCACCTGGACCGGGTGCCG
CTGACGGAGGCGCACAACACGCAGCTGGACACGGCGCTGTCGGTGGTGATGAGCGCCAACGGGGCGGCGGGCGAG
CCGACCATCATCGACCTGCCGGTGCACGAGGGCATCTCGACGGAGCCGGTGGTGTTCACGACGCGGGACGCGTCC
AAGGTGAAGCTGCTGTTCGACATCGTGCCGACGTACTCGGGCAGCGAGAAGAACAAGATCGGGCGGGCGGTGGCG
CTGCTGTCGTCGATCAAGCCGGCGCTGGGGACGCAGCGGGTCAGCCTGCAGGGCGACGTGTGCGTGCCGATCGTG
TCGAGCCAGCTGGAGGTGATCGGGACGGTCAACTTCAACTTCCTCGTCATCACGCCCTTCCACCACGCCAACATG
GAGGTGACGTCGCGGCAGACGTACTGGAAGAAGCTGTCGTCGACGATGCTCATCGGGCACCGGGGCCTGGGCAAG
AACCTGACGTCGAACAAGTCGCTGCAGCTGGGGGAGAACACGCTGCCGTCGTTCATCGCGGCGGCCAACCTGGGG
GCGCAACGGGCATCGACGCGCCGGTGCACACGCTGA
Gene >Hirsu2|932
ATGAAATTCGGACGCAAGTGAGTACGGCCCGAGGTCTCCCAGTCCTAGCCTCATCCTCCCCCCCCCCCTACCCGG
GCGAGAGGCGCCCAGTCGCTGAGACGAGCTCGTGCCAAGTCTTCCGCGCAACCAGGTCCCCGAGTGGGCGGCCTT
CTACATCAACTACAAGGGCCTCAAGAAACTAGTCAAGAGCGCGTCGGAAAAGGCCAAGAACGGGGACGCCGTCGA
TCCAGCAGGTGGGCGGCCCTGCCAGACTGTTCTGCCTCGGGGCTGAACCCCGTCCCCTAACCCATTTCTCCCCCC
ACTCTGCAGAGCTCTTCTTCGCCCTCGACCGCAATCTCGAGGACGTCGACTCCTTCTACAACAAGAAGCTCGCCG
AGGCCTGCCGCCGCCTCAACATCCTTCACAACCGCTATGGACGCGTCCCGGACGTCGTCGCCACCCTCGACCAGG
ACGAGGTCGAGGAGGTCATGGGCGCCCTGCTGGAGCTCCGGACCCAGCTGCGAAACCTGCAGTGGTTCGGCGAGA
TCAACCGCAGGGGCTTCGTCAAGATCACCAAGAAGCTCGATAAGAAGGTGCCCGGCATGTCGTCCCAGCTGAGCT
ACATATCGACCAAGGTCGACCCGAAGCCGTTTGCCAAGGACGGCAACACCAGCAGGCTGCTCGCCGAGATCAACC
GCTGGCTCTCCGTCCTGGGCGACGCCCAGAACATGGACGACTCCAACTCGGACCGCTCCACCCGCTCCCTCGGCC
GGGCCTCGGCCAAGGCCATGCTCCACCTCCCGCAGGCCCAGCTCGACGCGCTGGACCAGGCCGTCCGTAGCGACG
ACGTCGCCTCGCTCAGGTCCGGCCTCGACGACGCCAGCCTCGGTCAGGAGGCGCAGGCCCAGAGCCTGCTGCTCA
ACCTCCTGCAGCGCTCCATCTCGGCCCGGTCCAGGGCCTGCGTCGCCTTCCTGCTGCCGCGCATCAAGGACCTGG
ACGAGCCGGACGACATCAACGGCCGCAACTGCATCCACCGGCTCGTCATCCACATCGGCCGCACCAAGTCGGCGA
CGCCCGGCGACGACGGCGCAAGCCCGCACCCCGTGTCGGTCGGCGCGCAGTTCATCAACGGGCACCTCCAGCCCG
CCGTCTCGTCGACGGTGCCCGTCAAGTCGATCAACACGAGCGAAGGCGAGCGCCGCCTGGACGAGGACGACGAGG
CGGTGCAGACGCTCATCTACCTGCTCGACCAGCTGACGCCGGACCAGCGCCGCGCACTCAAGAGCCGCGACTCCT
TCGGCCGGCTGCCCCTCCACTACGCCGCCCAGTTCGGCTTCGTCGTCGTCTGCCAGATCATCATGGGCAAGATGC
AGGAGTGGGGCCAGTTCGACGTGCAGGACGGCATCGACGCGCCCGAGTGGCAGGACAACGACGGCTACGCGCCGC
TGCACCTCAGCGTCGTCGGCGGCCACCCGCTCACCACGCGCGCCCTGCTGCAGGGCGAGGAGCGGCAGGGGAGCG
GCGAGGACAAGGCGCAGCTGCACAAGAGCATCCCCAAGTCGGGGGCGGTCCTCGCGCTGGCGACACGGGCCAACT
ATGAGCCCATCGTTGAGATGCTGGTGCAGGCGGGCGTCGACGTCAACTGGACGGACAAGACGGGCGAGTCGGTCC
TGCACATCGCCGCCAGGTACGGGCACGTCGGCTGCGCGCACATCATCGTGCGGGGCAGCGAGTGGCACAAGGCGG
ACCTGGAGATCGCGGAGCACTCGTACTCGTGGACGCCGCTGCACGTGGCGGCCGTCGACGGCTCCATCGGCGTCG
TGCAGCTGCTGGTGGAGGCGGGCGCGGACGTGTCGCGGCCGGACGCGTCGGGCTGGACGGCCAAGGAGCACGCGG
CACTGCGCGGGCACATGGACATCGCGCGCCTCCTGGCCGCGCACACCAACGAGGTGGAGGCGGCGTCGAGGGTGG
CGGCGGGACTGCAGGCGGCGCCTAACGCGCCGGAGAACTCGTCGATCGACGAGCGACGGTCGAACGGGGCGAGCT
CGAACGGCGGCGTCGGCGTCGGCGGCGTCGGCGGCGGCGGCGGCGGACGGACGGCGGAGCCGGTCAAGAGCTTCG
GCCATCGCTACCTAACGAGCGAGAGCCTAGTGCTGGTCAGCCTGGGGACGATGGACATTCGCAAGAGCACGGACG
CGGTGCACCTGGACCGGGTGCCGCTGACGGAGGCGCACAACACGCAGCTGGACACGGCGCTGTCGGTGGTGATGA
GCGCCAACGGGGCGGCGGGCGAGCCGACCATCATCGACCTGCCGGTGCACGAGGGCATCTCGACGGAGCCGGTGG
TGTTCACGACGCGGGACGCGTCCAAGGTGAAGCTGCTGTTCGACATCGTGCCGACGTACTCGGGCAGCGAGAAGA
ACAAGATCGGGCGGGCGGTGGCGCTGCTGTCGTCGATCAAGCCGGCGCTGGGGACGCAGCGGGTCAGCCTGCAGG
GCGACGTGTGCGTGCCGATCGTGTCGAGCCAGCTGGAGGTGATCGGGACGGTCAACTTCAACTTCCTCGTCATCA
CGCCCTTCCACCACGCCAACATGGAGGTGACGTCGCGGCAGACGTACTGGAAGAAGCTGTCGTCGACGATGCTCA
TCGGGCACCGGGGCCTGGGCAAGAACCTGACGTCGAACAAGTCGCTGCAGCTGGGGGAGAACACGCTGCCGTCGT
TCATCGCGGCGGCCAACCTGGGGGCGCAGTACGTCGAGTTCGACGTGCAGCTGACCAAGGACCACGTGCCGGTCA
TCTACCACGACTTCCTCGTCAGCGAGACGGGCATCGACGCGCCGGTGCACACGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail