Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9316
Gene name
LocationContig_669:12186..13406
Strand-
Gene length (bp)1220
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04080 Per1 Per1-like family 1.4E-105 60 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6N9|PER1_SCHPO Protein PER1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.07 PE=3 SV=1 21 331 2.0E-69
sp|P25625|PER1_YEAST Protein PER1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PER1 PE=1 SV=1 12 318 4.0E-54
sp|Q0VFE3|PGAP3_XENTR Post-GPI attachment to proteins factor 3 OS=Xenopus tropicalis GN=pgap3 PE=2 SV=1 18 327 4.0E-54
sp|Q68EV0|PGAP3_XENLA Post-GPI attachment to proteins factor 3 OS=Xenopus laevis GN=pgap3 PE=2 SV=1 18 322 1.0E-53
sp|Q7K0P4|PGAP3_DROME Post-GPI attachment to proteins factor 3 OS=Drosophila melanogaster GN=PGAP3 PE=1 SV=2 13 313 4.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6N9|PER1_SCHPO Protein PER1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.07 PE=3 SV=1 21 331 2.0E-69
sp|P25625|PER1_YEAST Protein PER1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PER1 PE=1 SV=1 12 318 4.0E-54
sp|Q0VFE3|PGAP3_XENTR Post-GPI attachment to proteins factor 3 OS=Xenopus tropicalis GN=pgap3 PE=2 SV=1 18 327 4.0E-54
sp|Q68EV0|PGAP3_XENLA Post-GPI attachment to proteins factor 3 OS=Xenopus laevis GN=pgap3 PE=2 SV=1 18 322 1.0E-53
sp|Q7K0P4|PGAP3_DROME Post-GPI attachment to proteins factor 3 OS=Drosophila melanogaster GN=PGAP3 PE=1 SV=2 13 313 4.0E-48
sp|A8WFS8|PGAP3_DANRE Post-GPI attachment to proteins factor 3 OS=Danio rerio GN=pgap3 PE=2 SV=1 28 319 1.0E-47
sp|Q96FM1|PGAP3_HUMAN Post-GPI attachment to proteins factor 3 OS=Homo sapiens GN=PGAP3 PE=1 SV=2 28 319 2.0E-47
sp|A2V7M9|PGAP3_CRIGR Post-GPI attachment to proteins factor 3 OS=Cricetulus griseus GN=PGAP3 PE=2 SV=1 29 319 8.0E-47
sp|A7YWP2|PGAP3_BOVIN Post-GPI attachment to proteins factor 3 OS=Bos taurus GN=PGAP3 PE=2 SV=1 28 319 2.0E-46
sp|A2A559|PGAP3_MOUSE Post-GPI attachment to proteins factor 3 OS=Mus musculus GN=Pgap3 PE=2 SV=1 25 319 7.0E-46
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 147 165 18
3 175 194 19
4 206 225 19
5 230 252 22
6 264 282 18
7 297 316 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9316
MAPSDSGRPWTRVAVLTLLVLALCGAASASVGDRLPEFHHCLEVCRAENCAPGRRQTPIPLFRRLLFWNCGSECD
YTCQHIVTAERVASGRPVVQFHGKWPFRRVGGMQEPFSVLFSLGNLWAHAAGLAKVRARIPARYGLRPWYEWLAR
LGVAAWALSALFHTRDFALTEQLDYFAAGASVLYGMYYAPVRIFRLDRPEPRRRSLLRLWSALCALLYLAHVAYL
KGVRWDYTYNMAANVAAGIVQNVLWSWFSWDRYRKSRRFWAMWPGLVVAWVMFAMSMELFDFPPWLGCIDAHSLW
HLMTIGPTVLWYNFLVKDAHDDMAGTDRLKA*
Coding >Hirsu2|9316
ATGGCCCCCTCGGACTCGGGGCGGCCCTGGACCCGCGTCGCTGTGCTGACGCTGCTCGTGCTGGCGCTGTGCGGC
GCGGCCTCGGCCTCGGTCGGCGACCGCCTGCCCGAGTTCCATCACTGCCTCGAGGTCTGCCGGGCCGAAAACTGC
GCGCCCGGCCGACGGCAGACGCCGATCCCCCTCTTCCGCCGGCTGCTCTTCTGGAACTGCGGCTCCGAGTGCGAC
TACACGTGCCAGCACATCGTGACGGCGGAGCGCGTGGCGTCGGGCCGGCCCGTGGTGCAGTTCCACGGCAAGTGG
CCCTTCCGCCGCGTCGGCGGCATGCAGGAGCCCTTCTCCGTCCTCTTCTCCCTCGGCAACCTGTGGGCGCACGCG
GCCGGGCTGGCCAAGGTGCGGGCCCGCATCCCGGCCCGGTACGGCCTGCGGCCGTGGTACGAGTGGCTGGCCCGG
CTCGGCGTCGCCGCCTGGGCCCTCAGCGCCCTCTTCCACACCCGCGACTTCGCCCTGACCGAGCAGCTCGACTAC
TTCGCCGCCGGCGCCAGCGTCCTCTACGGCATGTACTACGCGCCCGTCCGCATCTTCCGCCTCGACCGCCCGGAG
CCCCGCCGCCGCTCCCTCCTCCGCCTCTGGTCCGCCCTCTGCGCCCTGCTCTACCTCGCCCACGTCGCCTACCTC
AAGGGCGTCCGCTGGGACTACACCTACAACATGGCCGCCAACGTCGCCGCCGGCATCGTCCAGAACGTCCTCTGG
TCCTGGTTCAGCTGGGACCGCTACCGCAAGTCGCGCCGCTTCTGGGCCATGTGGCCCGGCCTCGTCGTCGCCTGG
GTCATGTTCGCCATGAGCATGGAGCTCTTCGACTTCCCCCCCTGGCTCGGCTGCATCGACGCCCACAGCCTGTGG
CACCTCATGACCATTGGCCCGACCGTCCTGTGGTACAATTTCCTCGTCAAGGATGCTCACGATGATATGGCCGGC
ACCGATCGACTCAAAGCTTGA
Transcript >Hirsu2|9316
ATGGCCCCCTCGGACTCGGGGCGGCCCTGGACCCGCGTCGCTGTGCTGACGCTGCTCGTGCTGGCGCTGTGCGGC
GCGGCCTCGGCCTCGGTCGGCGACCGCCTGCCCGAGTTCCATCACTGCCTCGAGGTCTGCCGGGCCGAAAACTGC
GCGCCCGGCCGACGGCAGACGCCGATCCCCCTCTTCCGCCGGCTGCTCTTCTGGAACTGCGGCTCCGAGTGCGAC
TACACGTGCCAGCACATCGTGACGGCGGAGCGCGTGGCGTCGGGCCGGCCCGTGGTGCAGTTCCACGGCAAGTGG
CCCTTCCGCCGCGTCGGCGGCATGCAGGAGCCCTTCTCCGTCCTCTTCTCCCTCGGCAACCTGTGGGCGCACGCG
GCCGGGCTGGCCAAGGTGCGGGCCCGCATCCCGGCCCGGTACGGCCTGCGGCCGTGGTACGAGTGGCTGGCCCGG
CTCGGCGTCGCCGCCTGGGCCCTCAGCGCCCTCTTCCACACCCGCGACTTCGCCCTGACCGAGCAGCTCGACTAC
TTCGCCGCCGGCGCCAGCGTCCTCTACGGCATGTACTACGCGCCCGTCCGCATCTTCCGCCTCGACCGCCCGGAG
CCCCGCCGCCGCTCCCTCCTCCGCCTCTGGTCCGCCCTCTGCGCCCTGCTCTACCTCGCCCACGTCGCCTACCTC
AAGGGCGTCCGCTGGGACTACACCTACAACATGGCCGCCAACGTCGCCGCCGGCATCGTCCAGAACGTCCTCTGG
TCCTGGTTCAGCTGGGACCGCTACCGCAAGTCGCGCCGCTTCTGGGCCATGTGGCCCGGCCTCGTCGTCGCCTGG
GTCATGTTCGCCATGAGCATGGAGCTCTTCGACTTCCCCCCCTGGCTCGGCTGCATCGACGCCCACAGCCTGTGG
CACCTCATGACCATTGGCCCGACCGTCCTGTGGTACAATTTCCTCGTCAAGGATGCTCACGATGATATGGCCGGC
ACCGATCGACTCAAAGCTTGA
Gene >Hirsu2|9316
ATGGCCCCCTCGGACTCGGGGCGGCCCTGGACCCGCGTCGCTGTGCTGACGCTGCTCGTGCTGGCGCTGTGCGGC
GCGGCCTCGGCCTCGGTCGGCGACCGCCTGCCCGAGTTCCATCACTGCCTCGAGGTGCGTGTGCCGCCGCCGTCT
TGGGTCCGGAACCGTGCGGGCTGACGCTTCTTGCCCGCCTCGACAGGTCTGCCGGGCCGAAAACTGCGCGCCCGG
CCGACGGCAGACGCCGATCCGTTCGTCCTCCCTCCTCTCCCTTGTCCTCGTACCCCCCGGTCCGACGACGTTGCG
GCCCCGGCCGGCTGACAGGCAGATTAAAAAAAAAAAAACGACAGCCCTCTTCCGCCGGCTGCTCTTCTGGAACTG
CGGCTCCGAGTGCGACTACACGTGCCAGCACATCGTGACGGCGGAGCGCGTGGCGTCGGGCCGGCCCGTGGTGCA
GTTCCACGGCAAGTGGCCCTTCCGCCGCGTCGGCGGCATGCAGGAGCCCTTCTCCGTCCTCTTCTCCCTCGGCAA
CCTGTGGGCGCACGCGGCCGGGCTGGCCAAGGTGCGGGCCCGCATCCCGGCCCGGTACGGCCTGCGGCCGTGGTA
CGAGTGGCTGGCCCGGCTCGGCGTCGCCGCCTGGGCCCTCAGCGCCCTCTTCCACACCCGCGACTTCGCCCTGAC
CGAGCAGCTCGACTACTTCGCCGCCGGCGCCAGCGTCCTCTACGGCATGTACTACGCGCCCGTCCGCATCTTCCG
CCTCGACCGCCCGGAGCCCCGCCGCCGCTCCCTCCTCCGCCTCTGGTCCGCCCTCTGCGCCCTGCTCTACCTCGC
CCACGTCGCCTACCTCAAGGGCGTCCGCTGGGACTACACCTACAACATGGCCGCCAACGTCGCCGCCGGCATCGT
CCAGAACGTCCTCTGGTCCTGGTTCAGCTGGGACCGCTACCGCAAGTCGCGCCGCTTCTGGGCCATGTGGCCCGG
CCTCGTCGTCGCCTGGGTCATGTTCGCCATGAGCATGGAGCTCTTCGACTTCCCCCCCTGGCTCGGCTGCATCGA
CGCCCACAGCCTGTGGCACCTCATGACCATTGGCCCGACCGTCCTGTGGTACAAGTGAGTCCTACACGAGGAAAC
GCACAAACACCACAGCCCCGACGCTGACCCGGTCCAGTTTCCTCGTCAAGGATGCTCACGATGATATGGCCGGCA
CCGATCGACTCAAAGCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail