Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9304
Gene name
LocationContig_667:13167..14421
Strand-
Gene length (bp)1254
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04258 Peptidase_A22B Signal peptide peptidase 4.4E-28 39 160
PF04258 Peptidase_A22B Signal peptide peptidase 1.5E-18 230 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49049|IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans GN=imp-2 PE=1 SV=1 68 300 3.0E-23
sp|P34248|YKK0_YEAST Probable intramembrane protease YKL100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL100C PE=1 SV=1 53 295 3.0E-22
sp|Q6ZGL9|SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1 30 156 1.0E-19
sp|B9FJ61|SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=2 SV=1 66 156 3.0E-19
sp|O81062|SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana GN=SPP PE=2 SV=1 66 156 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49049|IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans GN=imp-2 PE=1 SV=1 68 300 3.0E-23
sp|P34248|YKK0_YEAST Probable intramembrane protease YKL100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL100C PE=1 SV=1 53 295 3.0E-22
sp|Q6ZGL9|SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1 30 156 1.0E-19
sp|B9FJ61|SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=2 SV=1 66 156 3.0E-19
sp|O81062|SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana GN=SPP PE=2 SV=1 66 156 1.0E-18
sp|Q9UTA3|YL8H_SCHPO Probable intramembrane protease C25B8.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.17 PE=3 SV=1 40 172 3.0E-18
sp|Q9D8V0|HM13_MOUSE Minor histocompatibility antigen H13 OS=Mus musculus GN=Hm13 PE=1 SV=1 1 158 3.0E-14
sp|Q8TCT9|HM13_HUMAN Minor histocompatibility antigen H13 OS=Homo sapiens GN=HM13 PE=1 SV=1 1 158 5.0E-14
sp|Q8TCT6|SPPL3_HUMAN Signal peptide peptidase-like 3 OS=Homo sapiens GN=SPPL3 PE=1 SV=1 44 290 8.0E-13
sp|Q9CUS9|SPPL3_MOUSE Signal peptide peptidase-like 3 OS=Mus musculus GN=Sppl3 PE=1 SV=3 44 290 8.0E-13
sp|Q9D8V0|HM13_MOUSE Minor histocompatibility antigen H13 OS=Mus musculus GN=Hm13 PE=1 SV=1 234 299 2.0E-10
sp|Q8TCT9|HM13_HUMAN Minor histocompatibility antigen H13 OS=Homo sapiens GN=HM13 PE=1 SV=1 234 321 2.0E-10
sp|Q9JJF9|SPP2A_MOUSE Signal peptide peptidase-like 2A OS=Mus musculus GN=Sppl2a PE=1 SV=2 214 302 5.0E-10
sp|Q8TCT8|SPP2A_HUMAN Signal peptide peptidase-like 2A OS=Homo sapiens GN=SPPL2A PE=1 SV=2 214 306 2.0E-09
sp|Q5F383|SPP2B_CHICK Signal peptide peptidase-like 2B OS=Gallus gallus GN=SPPL2B PE=2 SV=1 66 365 1.0E-08
sp|Q5N808|SIPL3_ORYSJ Signal peptide peptidase-like 3 OS=Oryza sativa subsp. japonica GN=SPPL3 PE=2 SV=1 236 291 1.0E-07
sp|Q5PQL3|SPP2B_RAT Signal peptide peptidase-like 2B OS=Rattus norvegicus GN=Sppl2b PE=2 SV=1 214 354 1.0E-07
sp|Q3TD49|SPP2B_MOUSE Signal peptide peptidase-like 2B OS=Mus musculus GN=Sppl2b PE=1 SV=2 214 290 1.0E-07
sp|Q53P98|SIPL2_ORYSJ Signal peptide peptidase-like 2 OS=Oryza sativa subsp. japonica GN=SPPL2 PE=2 SV=1 236 302 3.0E-07
sp|Q8TCT7|SPP2B_HUMAN Signal peptide peptidase-like 2B OS=Homo sapiens GN=SPPL2B PE=1 SV=2 214 290 9.0E-07
sp|B9FJ61|SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=2 SV=1 236 310 2.0E-06
sp|A2A6C4|SPP2C_MOUSE Signal peptide peptidase-like 2C OS=Mus musculus GN=Sppl2c PE=2 SV=1 234 368 2.0E-06
sp|Q9MA44|SIPL5_ARATH Signal peptide peptidase-like 5 OS=Arabidopsis thaliana GN=SPPL5 PE=2 SV=1 236 292 2.0E-06
sp|Q6ZGL9|SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1 236 295 4.0E-06
sp|Q0DWA9|SIPL4_ORYSJ Signal peptide peptidase-like 4 OS=Oryza sativa subsp. japonica GN=SPPL4 PE=2 SV=1 236 290 4.0E-06
sp|Q0WMJ8|SIPL4_ARATH Signal peptide peptidase-like 4 OS=Arabidopsis thaliana GN=SPPL4 PE=2 SV=1 227 294 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004190 aspartic-type endopeptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008233 peptidase activity No
GO:0070001 aspartic-type peptidase activity No
GO:0044425 membrane part No
GO:0004175 endopeptidase activity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 93 115 22
3 135 154 19
4 236 258 22
5 265 282 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9304
LGLLARSERPRRAAWELRGLLTRKWLLKLFMHGVGEEKAKIKFAHMTALFLSVMTALVYFSTTSPLLSNMLGYGM
CYGSFLILSPTDFLTGSLVLVGLFVYDIVMVFYTPYMITVASKLDVPIKLTFATAARRSMLGLGDIVIPGMLIGW
ALRLDLYLHYLRKVKYESTELKIIEKDAASGQVVTRTETKHKEVKAPYVNVKGKWGEWLWTRGGLFLARPRQLPA
ELAASAFPKTYFYASMTGYALGMMLTLAMLLVFNKGQPALLYLVPGVLGSVIAVALARGEMAAVWRYTEDGSLDT
MDVVVDLDGEGRAINTLGKMEDGVVDTTKAKEDGKKTSSGKADGKAKKEAKGTTAKGDDDAPGHKGHKVFLLSLE
ASARTEEDD*
Coding >Hirsu2|9304
CTGGGACTCCTCGCCCGGTCCGAGAGGCCGAGGCGGGCCGCGTGGGAGCTGCGCGGCCTCCTGACCCGCAAGTGG
CTCCTCAAGCTGTTCATGCACGGCGTCGGCGAGGAGAAGGCCAAGATCAAGTTTGCCCACATGACGGCCCTGTTC
CTGTCCGTCATGACGGCCCTCGTCTACTTCTCGACCACCTCGCCGCTGCTCTCCAACATGCTGGGCTACGGCATG
TGCTACGGCTCCTTTCTCATCCTCTCGCCCACCGACTTCCTGACGGGCTCTCTGGTCCTCGTCGGGCTCTTCGTT
TACGACATCGTCATGGTCTTTTACACGCCCTACATGATCACCGTCGCAAGCAAGCTGGACGTGCCCATCAAACTG
ACCTTCGCCACGGCGGCGAGGAGGAGCATGCTGGGGCTGGGGGACATTGTGATCCCGGGCATGCTCATCGGGTGG
GCACTGAGGCTGGACCTGTACCTGCACTACCTCCGCAAGGTCAAGTACGAGTCCACGGAGCTCAAGATCATCGAG
AAGGACGCGGCGTCGGGCCAGGTCGTGACCCGGACCGAGACCAAGCACAAGGAGGTCAAGGCGCCGTACGTCAAC
GTCAAGGGCAAGTGGGGGGAGTGGCTGTGGACGCGCGGCGGGCTGTTCCTCGCGCGCCCCCGGCAGCTGCCCGCC
GAGCTGGCGGCGTCGGCCTTCCCCAAGACGTACTTCTACGCCTCCATGACGGGCTACGCACTGGGCATGATGCTG
ACGCTGGCCATGCTGCTCGTCTTCAACAAGGGCCAGCCGGCGCTGCTGTACCTCGTCCCGGGCGTGCTGGGCTCG
GTCATCGCCGTGGCGCTGGCGCGGGGCGAGATGGCGGCCGTGTGGAGGTACACCGAGGACGGCAGCCTCGACACC
ATGGACGTCGTCGTCGACCTCGACGGCGAGGGCCGCGCCATCAACACGCTGGGCAAGATGGAGGACGGCGTCGTC
GACACGACCAAGGCCAAGGAGGACGGCAAGAAGACCTCTTCCGGCAAGGCGGACGGCAAGGCCAAGAAGGAGGCG
AAAGGCACGACTGCCAAGGGGGATGACGACGCGCCGGGCCACAAGGGCCACAAGGTCTTCTTGCTCTCGCTCGAG
GCGTCTGCTCGCACGGAGGAAGACGACTGA
Transcript >Hirsu2|9304
CTGGGACTCCTCGCCCGGTCCGAGAGGCCGAGGCGGGCCGCGTGGGAGCTGCGCGGCCTCCTGACCCGCAAGTGG
CTCCTCAAGCTGTTCATGCACGGCGTCGGCGAGGAGAAGGCCAAGATCAAGTTTGCCCACATGACGGCCCTGTTC
CTGTCCGTCATGACGGCCCTCGTCTACTTCTCGACCACCTCGCCGCTGCTCTCCAACATGCTGGGCTACGGCATG
TGCTACGGCTCCTTTCTCATCCTCTCGCCCACCGACTTCCTGACGGGCTCTCTGGTCCTCGTCGGGCTCTTCGTT
TACGACATCGTCATGGTCTTTTACACGCCCTACATGATCACCGTCGCAAGCAAGCTGGACGTGCCCATCAAACTG
ACCTTCGCCACGGCGGCGAGGAGGAGCATGCTGGGGCTGGGGGACATTGTGATCCCGGGCATGCTCATCGGGTGG
GCACTGAGGCTGGACCTGTACCTGCACTACCTCCGCAAGGTCAAGTACGAGTCCACGGAGCTCAAGATCATCGAG
AAGGACGCGGCGTCGGGCCAGGTCGTGACCCGGACCGAGACCAAGCACAAGGAGGTCAAGGCGCCGTACGTCAAC
GTCAAGGGCAAGTGGGGGGAGTGGCTGTGGACGCGCGGCGGGCTGTTCCTCGCGCGCCCCCGGCAGCTGCCCGCC
GAGCTGGCGGCGTCGGCCTTCCCCAAGACGTACTTCTACGCCTCCATGACGGGCTACGCACTGGGCATGATGCTG
ACGCTGGCCATGCTGCTCGTCTTCAACAAGGGCCAGCCGGCGCTGCTGTACCTCGTCCCGGGCGTGCTGGGCTCG
GTCATCGCCGTGGCGCTGGCGCGGGGCGAGATGGCGGCCGTGTGGAGGTACACCGAGGACGGCAGCCTCGACACC
ATGGACGTCGTCGTCGACCTCGACGGCGAGGGCCGCGCCATCAACACGCTGGGCAAGATGGAGGACGGCGTCGTC
GACACGACCAAGGCCAAGGAGGACGGCAAGAAGACCTCTTCCGGCAAGGCGGACGGCAAGGCCAAGAAGGAGGCG
AAAGGCACGACTGCCAAGGGGGATGACGACGCGCCGGGCCACAAGGGCCACAAGGTCTTCTTGCTCTCGCTCGAG
GCGTCTGCTCGCACGGAGGAAGACGACTGA
Gene >Hirsu2|9304
CTGGGACTCCTCGCCCGGTCCGAGAGGCCGAGGCGGGCCGCGTGGGAGCTGCGCGGCCTCCTGACCCGCAAGTGG
CTCCTCAAGCTGTTCATGCACGGCGTCGGCGAGGAGAAGGCCAAGATCAAGTTTGCCCACATGACGGCCCTGTTC
CTGTCCGTCATGACGGCCCTCGTCTACTTCTCGACCACCTCGCCGCTGCTCTCCAACATGCTGGGCTACGGCATG
TGCTACGGCTCCTTTCTCATCCTCTCGCCCACCGACTTCCTGACGGGCTCTCTGGTCCTCGTCGGGCTCTTCGTT
TACGACATCGTCATGGTCTTTTACACGTAAGCTCCCCCTTCCCAACCCATCCTCGTCCTGCAGCTTGTCACGGGC
ATGCGGAAGCACGGGCGCCGCTTGGCCGGACTAACCACGGGCCCCGTCAGGCCCTACATGATCACCGTCGCAAGC
AAGCTGGACGTGCCCATCAAACTGACCTTCGCCACGGCGGCGAGGAGGAGCATGCTGGGGCTGGGGGACATTGTG
ATCCCGGGCATGCTCATCGGGTGGGCACTGAGGCTGGACCTGTACCTGCACTACCTCCGCAAGGTCAAGTACGAG
TCCACGGAGCTCAAGATCATCGAGAAGGACGCGGCGTCGGGCCAGGTCGTGACCCGGACCGAGACCAAGCACAAG
GAGGTCAAGGCGCCGTACGTCAACGTCAAGGGCAAGTGGGGGGAGTGGCTGTGGACGCGCGGCGGGCTGTTCCTC
GCGCGCCCCCGGCAGCTGCCCGCCGAGCTGGCGGCGTCGGCCTTCCCCAAGACGTACTTCTACGCCTCCATGACG
GGCTACGCACTGGGCATGATGCTGACGCTGGCCATGCTGCTCGTCTTCAACAAGGGCCAGCCGGCGCTGCTGTAC
CTCGTCCCGGGCGTGCTGGGCTCGGTCATCGCCGTGGCGCTGGCGCGGGGCGAGATGGCGGCCGTGTGGAGGTAC
ACCGAGGACGGCAGCCTCGACACCATGGACGTCGTCGTCGACCTCGACGGCGAGGGCCGCGCCATCAACACGCTG
GGCAAGATGGAGGACGGCGTCGTCGACACGACCAAGGCCAAGGAGGACGGCAAGAAGACCTCTTCCGGCAAGGCG
GACGGCAAGGCCAAGAAGGAGGCGAAAGGCACGACTGCCAAGGGGGATGACGACGCGCCGGGCCACAAGGGCCAC
AAGGTCTTCTTGCTCTCGCTCGAGGCGTCTGCTCGCACGGAGGAAGACGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail