Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9291
Gene name
LocationContig_666:4936..7440
Strand+
Gene length (bp)2504
Transcript length (bp)2226
Coding sequence length (bp)2226
Protein length (aa) 742

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04547 Anoctamin Calcium-activated chloride channel 9.5E-97 196 660

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13621|YNG5_SCHPO Uncharacterized protein C691.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi030 PE=4 SV=1 65 648 1.0E-73
sp|Q9NW15|ANO10_HUMAN Anoctamin-10 OS=Homo sapiens GN=ANO10 PE=1 SV=2 163 644 5.0E-29
sp|Q8BH79|ANO10_MOUSE Anoctamin-10 OS=Mus musculus GN=Ano10 PE=1 SV=1 163 644 2.0E-28
sp|P38250|IST2_YEAST Increased sodium tolerance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST2 PE=1 SV=2 159 648 5.0E-28
sp|Q4V8U5|ANO10_DANRE Anoctamin-10 OS=Danio rerio GN=ano10 PE=2 SV=1 167 644 1.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13621|YNG5_SCHPO Uncharacterized protein C691.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi030 PE=4 SV=1 65 648 1.0E-73
sp|Q9NW15|ANO10_HUMAN Anoctamin-10 OS=Homo sapiens GN=ANO10 PE=1 SV=2 163 644 5.0E-29
sp|Q8BH79|ANO10_MOUSE Anoctamin-10 OS=Mus musculus GN=Ano10 PE=1 SV=1 163 644 2.0E-28
sp|P38250|IST2_YEAST Increased sodium tolerance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST2 PE=1 SV=2 159 648 5.0E-28
sp|Q4V8U5|ANO10_DANRE Anoctamin-10 OS=Danio rerio GN=ano10 PE=2 SV=1 167 644 1.0E-25
sp|Q6IWH7|ANO7_HUMAN Anoctamin-7 OS=Homo sapiens GN=ANO7 PE=1 SV=2 110 602 7.0E-21
sp|Q0JJZ6|CACLC_ORYSJ Anoctamin-like protein Os01g0706700 OS=Oryza sativa subsp. japonica GN=Os01g0706700 PE=2 SV=1 163 593 3.0E-20
sp|Q6IFT6|ANO7_RAT Anoctamin-7 OS=Rattus norvegicus GN=Ano7 PE=2 SV=1 167 612 5.0E-20
sp|Q14AT5|ANO7_MOUSE Anoctamin-7 OS=Mus musculus GN=Ano7 PE=2 SV=2 167 612 2.0E-19
sp|Q6PB70|ANO8_MOUSE Anoctamin-8 OS=Mus musculus GN=Ano8 PE=1 SV=3 153 409 4.0E-19
sp|Q9HCE9|ANO8_HUMAN Anoctamin-8 OS=Homo sapiens GN=ANO8 PE=1 SV=3 153 409 2.0E-18
sp|A0MFS9|CACLC_ARATH Anoctamin-like protein At1g73020 OS=Arabidopsis thaliana GN=At1g73020 PE=1 SV=1 64 641 3.0E-17
sp|Q8BHY3|ANO1_MOUSE Anoctamin-1 OS=Mus musculus GN=Ano1 PE=1 SV=2 222 613 2.0E-15
sp|Q9BYT9|ANO3_HUMAN Anoctamin-3 OS=Homo sapiens GN=ANO3 PE=1 SV=2 170 613 5.0E-14
sp|Q9NQ90|ANO2_HUMAN Anoctamin-2 OS=Homo sapiens GN=ANO2 PE=1 SV=2 194 613 1.0E-12
sp|A2AHL1|ANO3_MOUSE Anoctamin-3 OS=Mus musculus GN=Ano3 PE=1 SV=1 170 613 2.0E-12
sp|Q8CFW1|ANO2_MOUSE Anoctamin-2 OS=Mus musculus GN=Ano2 PE=1 SV=2 194 613 2.0E-11
sp|Q6PB70|ANO8_MOUSE Anoctamin-8 OS=Mus musculus GN=Ano8 PE=1 SV=3 503 670 8.0E-10
sp|Q9HCE9|ANO8_HUMAN Anoctamin-8 OS=Homo sapiens GN=ANO8 PE=1 SV=3 503 594 2.0E-09
sp|Q8C5H1|ANO4_MOUSE Anoctamin-4 OS=Mus musculus GN=Ano4 PE=2 SV=2 222 613 6.0E-07
sp|Q32M45|ANO4_HUMAN Anoctamin-4 OS=Homo sapiens GN=ANO4 PE=2 SV=1 222 613 7.0E-07
sp|A6QLE6|ANO4_BOVIN Anoctamin-4 OS=Bos taurus GN=ANO4 PE=2 SV=1 222 613 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 205 227 22
2 237 254 17
3 312 334 22
4 349 371 22
5 392 414 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9291
MESELQFKVVRQSSWEVFSAAAHRELVPPQFAAQLQHLAYNDKYVIRYNFGDVDDEAAIHGYTVLLNCLEAVGLH
TEVRVGHDHSLLVFVKAPREILGSAVYKSRVRDWLYGIVADHPGGGGQTILEGKYEAEDLLSMYHLLSWPKDMGG
AGITPGFAQFDNVHSIFPLHNPRTNQALLRHLGKKLILKDDDFDQIRDLLGTKAAFYFAFTQTYILFLLFPAVTG
VLARFFLTSYSQFYTLLTGLWCTVFVEVWKMKQTDLSLRWGVKGVGGLTTDRPQFAYEKVIVDDVGRTRHYCPKW
KQIARRLVQIPFVLLAAMSLGALIAMVFAIEVLISEAYDGPYKSYLEYLPTALLAIVLPYISNFLEGAAEALTEF
ENHRTADSHERSLAQKVFVLNFTTQYLPVILTAFVYVPFGDFFVPHLERVLRYVLGDAAKFSDTPFQANPNRLQK
EVIALTVTGQISHFGEEFLFPLIKQKFRSWYRNYRDSPSAAAAAGLDHFIHEDQPEEQALLTAARNQASLPPYDV
QADISQMTLQFGHLALFSPVWPLMPIGFLINNWIELRSDFLKICIEHQRPPPLRADGIGPWVQNLGFLAWLGSIS
TAAITHLFGPNVVVFENSLVSGWWTLPLTIVISEHVFLAVRAVVQSLLHRIGSEQIRKKRDDNYMRRKKHLDELE
ANKSEMLGLGVEQRERRKSVLITAGNSFWTRQVEDGKSKEVGVQLIQTLKRTKKGGEKGTEKGKLD*
Coding >Hirsu2|9291
ATGGAGTCTGAGCTCCAGTTCAAGGTGGTGCGCCAGTCATCGTGGGAAGTCTTCTCCGCCGCGGCGCATCGAGAG
CTCGTCCCTCCTCAATTCGCCGCGCAGCTCCAGCATCTTGCCTACAACGACAAGTATGTCATCCGCTACAACTTC
GGCGACGTCGACGACGAGGCGGCCATCCATGGCTACACCGTCCTCTTGAACTGTCTCGAGGCTGTCGGGCTTCAC
ACCGAGGTGAGGGTTGGCCACGACCACTCTCTCCTGGTCTTTGTCAAGGCCCCCCGCGAGATCCTGGGCAGCGCC
GTGTACAAGTCCCGGGTGAGGGACTGGCTCTACGGCATCGTCGCCGATCATCCGGGCGGCGGAGGCCAGACCATC
TTGGAAGGGAAATACGAGGCCGAAGACCTGCTTTCCATGTATCATTTGCTGAGCTGGCCCAAAGACATGGGCGGC
GCGGGCATCACGCCCGGCTTTGCCCAGTTCGACAATGTCCATTCCATCTTCCCCCTCCACAACCCACGCACCAAC
CAGGCCTTGCTCCGGCATCTCGGCAAAAAGCTGATCCTCAAAGACGACGACTTTGACCAGATCCGCGACCTTCTC
GGCACAAAGGCAGCCTTCTACTTCGCCTTCACCCAAACTTACATCCTTTTTCTCCTCTTCCCTGCCGTAACGGGT
GTCCTCGCCCGGTTTTTCCTGACGTCCTACTCCCAGTTCTACACCCTCTTGACTGGGCTGTGGTGCACTGTCTTC
GTCGAGGTCTGGAAGATGAAACAGACCGACCTAAGCCTGCGATGGGGCGTCAAAGGCGTCGGCGGCCTCACCACC
GATCGCCCGCAATTCGCCTACGAGAAGGTGATTGTGGATGACGTCGGCCGAACTCGGCACTACTGTCCCAAGTGG
AAGCAGATAGCCCGTCGGCTAGTCCAGATTCCCTTTGTTCTGCTCGCTGCAATGAGCCTAGGTGCTCTCATTGCC
ATGGTCTTCGCCATCGAGGTCCTGATCTCTGAGGCCTATGACGGGCCATATAAATCGTATCTTGAATACCTGCCG
ACGGCGCTTCTCGCCATTGTGTTGCCCTACATCAGCAATTTCTTGGAAGGTGCTGCGGAAGCGCTTACAGAGTTC
GAGAACCATCGCACCGCAGATTCTCATGAACGCTCTCTGGCGCAAAAGGTCTTCGTGCTCAACTTCACCACGCAG
TATCTCCCCGTCATTCTCACCGCCTTCGTCTACGTCCCGTTTGGAGACTTTTTCGTCCCCCATCTGGAGCGTGTC
CTCCGATACGTCCTGGGCGATGCTGCCAAATTCTCCGACACGCCCTTCCAGGCCAACCCGAACCGCCTCCAGAAG
GAGGTCATCGCCCTCACTGTGACGGGTCAAATATCGCACTTTGGCGAAGAGTTCCTCTTTCCCTTGATCAAGCAG
AAATTCCGTTCGTGGTATCGCAACTACCGCGATTCGCCCTCCGCAGCCGCGGCGGCTGGTCTGGACCATTTCATC
CACGAAGATCAGCCGGAGGAACAGGCCCTCCTGACCGCCGCTCGCAACCAGGCGTCCCTTCCGCCGTATGACGTG
CAGGCCGACATATCGCAAATGACCCTTCAGTTCGGCCACCTCGCACTCTTCAGCCCTGTGTGGCCGCTCATGCCG
ATCGGGTTCCTGATCAACAACTGGATCGAGCTGCGCTCCGACTTCCTCAAGATATGCATCGAGCATCAACGGCCA
CCGCCTTTGCGGGCAGATGGCATCGGCCCGTGGGTGCAGAATCTGGGCTTCTTGGCCTGGCTCGGCAGCATCTCG
ACTGCGGCCATCACGCATCTGTTTGGGCCAAACGTGGTCGTCTTTGAGAACTCCCTGGTCAGCGGCTGGTGGACC
TTACCACTCACCATCGTCATCAGCGAGCATGTCTTCCTGGCCGTGAGGGCCGTGGTGCAGTCTTTGCTGCATCGG
ATCGGGTCAGAACAGATCCGCAAGAAGAGAGATGACAATTACATGCGGAGGAAAAAGCACCTGGACGAGCTGGAG
GCAAACAAGAGCGAGATGCTCGGTCTCGGAGTGGAGCAGAGAGAACGAAGGAAATCTGTCTTGATAACTGCCGGC
AACAGCTTTTGGACGAGGCAGGTCGAGGATGGCAAGAGTAAAGAAGTTGGTGTTCAGCTGATCCAGACCCTCAAA
AGGACCAAGAAGGGGGGTGAAAAAGGAACTGAAAAGGGCAAATTGGACTAG
Transcript >Hirsu2|9291
ATGGAGTCTGAGCTCCAGTTCAAGGTGGTGCGCCAGTCATCGTGGGAAGTCTTCTCCGCCGCGGCGCATCGAGAG
CTCGTCCCTCCTCAATTCGCCGCGCAGCTCCAGCATCTTGCCTACAACGACAAGTATGTCATCCGCTACAACTTC
GGCGACGTCGACGACGAGGCGGCCATCCATGGCTACACCGTCCTCTTGAACTGTCTCGAGGCTGTCGGGCTTCAC
ACCGAGGTGAGGGTTGGCCACGACCACTCTCTCCTGGTCTTTGTCAAGGCCCCCCGCGAGATCCTGGGCAGCGCC
GTGTACAAGTCCCGGGTGAGGGACTGGCTCTACGGCATCGTCGCCGATCATCCGGGCGGCGGAGGCCAGACCATC
TTGGAAGGGAAATACGAGGCCGAAGACCTGCTTTCCATGTATCATTTGCTGAGCTGGCCCAAAGACATGGGCGGC
GCGGGCATCACGCCCGGCTTTGCCCAGTTCGACAATGTCCATTCCATCTTCCCCCTCCACAACCCACGCACCAAC
CAGGCCTTGCTCCGGCATCTCGGCAAAAAGCTGATCCTCAAAGACGACGACTTTGACCAGATCCGCGACCTTCTC
GGCACAAAGGCAGCCTTCTACTTCGCCTTCACCCAAACTTACATCCTTTTTCTCCTCTTCCCTGCCGTAACGGGT
GTCCTCGCCCGGTTTTTCCTGACGTCCTACTCCCAGTTCTACACCCTCTTGACTGGGCTGTGGTGCACTGTCTTC
GTCGAGGTCTGGAAGATGAAACAGACCGACCTAAGCCTGCGATGGGGCGTCAAAGGCGTCGGCGGCCTCACCACC
GATCGCCCGCAATTCGCCTACGAGAAGGTGATTGTGGATGACGTCGGCCGAACTCGGCACTACTGTCCCAAGTGG
AAGCAGATAGCCCGTCGGCTAGTCCAGATTCCCTTTGTTCTGCTCGCTGCAATGAGCCTAGGTGCTCTCATTGCC
ATGGTCTTCGCCATCGAGGTCCTGATCTCTGAGGCCTATGACGGGCCATATAAATCGTATCTTGAATACCTGCCG
ACGGCGCTTCTCGCCATTGTGTTGCCCTACATCAGCAATTTCTTGGAAGGTGCTGCGGAAGCGCTTACAGAGTTC
GAGAACCATCGCACCGCAGATTCTCATGAACGCTCTCTGGCGCAAAAGGTCTTCGTGCTCAACTTCACCACGCAG
TATCTCCCCGTCATTCTCACCGCCTTCGTCTACGTCCCGTTTGGAGACTTTTTCGTCCCCCATCTGGAGCGTGTC
CTCCGATACGTCCTGGGCGATGCTGCCAAATTCTCCGACACGCCCTTCCAGGCCAACCCGAACCGCCTCCAGAAG
GAGGTCATCGCCCTCACTGTGACGGGTCAAATATCGCACTTTGGCGAAGAGTTCCTCTTTCCCTTGATCAAGCAG
AAATTCCGTTCGTGGTATCGCAACTACCGCGATTCGCCCTCCGCAGCCGCGGCGGCTGGTCTGGACCATTTCATC
CACGAAGATCAGCCGGAGGAACAGGCCCTCCTGACCGCCGCTCGCAACCAGGCGTCCCTTCCGCCGTATGACGTG
CAGGCCGACATATCGCAAATGACCCTTCAGTTCGGCCACCTCGCACTCTTCAGCCCTGTGTGGCCGCTCATGCCG
ATCGGGTTCCTGATCAACAACTGGATCGAGCTGCGCTCCGACTTCCTCAAGATATGCATCGAGCATCAACGGCCA
CCGCCTTTGCGGGCAGATGGCATCGGCCCGTGGGTGCAGAATCTGGGCTTCTTGGCCTGGCTCGGCAGCATCTCG
ACTGCGGCCATCACGCATCTGTTTGGGCCAAACGTGGTCGTCTTTGAGAACTCCCTGGTCAGCGGCTGGTGGACC
TTACCACTCACCATCGTCATCAGCGAGCATGTCTTCCTGGCCGTGAGGGCCGTGGTGCAGTCTTTGCTGCATCGG
ATCGGGTCAGAACAGATCCGCAAGAAGAGAGATGACAATTACATGCGGAGGAAAAAGCACCTGGACGAGCTGGAG
GCAAACAAGAGCGAGATGCTCGGTCTCGGAGTGGAGCAGAGAGAACGAAGGAAATCTGTCTTGATAACTGCCGGC
AACAGCTTTTGGACGAGGCAGGTCGAGGATGGCAAGAGTAAAGAAGTTGGTGTTCAGCTGATCCAGACCCTCAAA
AGGACCAAGAAGGGGGGTGAAAAAGGAACTGAAAAGGGCAAATTGGACTAG
Gene >Hirsu2|9291
ATGGAGTCTGAGCTCCAGTTCAAGGTGGTGCGCCAGTCATCGTGGGAAGTCTTCTCCGCCGCGGCGCATCGAGAG
CTCGTCCCTCCTCAATTCGCCGCGCAGCTCCAGCATCTTGCCTACAACGACAAGTATGTCATCCGCTACAACTTC
GGCGACGTCGGTAAGCCGTCACTCGCGGTCCCTGCCCTTCCGAAGCTGCCGCCGCAGGCCCCTGACCAGTGCCCG
GTAGACGACGAGGCGGCCATCCATGGCTACACCGTCCTCTTGAACTGTCTCGAGGCTGTCGGGCTTCACACCGAG
GTGAGGGTTGGCCACGACCACTCTCTCCTGGTCTTTGTCAAGGCCCCCCGCGAGATCCTGGGCAGCGCCGTGTAC
AAGTCCCGGTAGGCACCTCGCTGCTGCTCGCCCCTCCGTGTCAGCCTGACGCCCAGACACTGACGATTCACTCAC
CAGGGTGAGGGACTGGCTCTACGGCATCGTCGCCGATCATCCGGGCGGCGGAGGCCAGACCATCTTGGAAGGGAA
ATACGAGGCCGAAGACCTGCTTTCCATGTATCATTTGCTGAGCTGGCCCAAAGACATGGGCGGCGCGGGCATCAC
GCCCGGCTTTGCCCAGTTCGACAATGTCCATTCCATCTTCCCCCTCCACAACCCACGCACCAACCAGGCCTTGCT
CCGGCATCTCGGCAAAAAGCTGATCCTCAAAGACGACGACTTTGACCAGATCCGCGACCTTCTCGGCACAAAGGT
GAGCTCACGAGCCCCACGTGCAATCCTGCCGTTCTAACTCGAGACGCATCAAGGCAGCCTTCTACTTCGCCTTCA
CCCAAACTTACATCCTTTTTCTCCTCTTCCCTGCCGTAACGGGTGTCCTCGCCCGGTTTTTCCTGACGTCCTACT
CCCAGTTCTACACCCTCTTGACTGGGCTGTGGTGCACTGTCTTCGTCGAGGTCTGGAAGATGAAACAGACCGACC
TAAGCCTGCGATGGGGCGTCAAAGGCGTCGGCGGCCTCACCACCGATCGCCCGCAATTCGCCTACGAGAAGGTGA
TTGTGGATGACGTCGGCCGAACTCGGCACTACTGTCCCAAGTGGAAGCAGATAGCCCGTCGGCTAGTCCAGATTC
CCTTTGTTCTGCTCGCTGCAATGAGCCTAGGTGCTCTCATTGCCATGGTCTTCGCCATCGAGGTCCTGATCTCTG
AGGCCTATGACGGGCCATATAAATCGTATCTTGTACGGCCCAGACTCTCCTCGCCACCCCTCTTCACTCCCCCCT
GTCATACTCTTTGGCGGTACAAAGCTCACCGATGCAAACAGGAATACCTGCCGACGGCGCTTCTCGCCATTGTGT
TGCCCTACATCAGCAATTTCTTGGAAGGTGCTGCGGAAGCGCTTACAGAGTTCGAGAACCATCGCACCGCAGATT
CTCATGAACGCTCTCTGGCGCAAAAGGTCTTCGTGCTCAACTTCACCACGCAGTATCTCCCCGTCATTCTCACCG
CCTTCGTCTACGTCCCGTTTGGAGACTTTTTCGTCCCCCATCTGGAGCGTGTCCTCCGATACGTCCTGGGCGATG
CTGCCAAATTCTCCGACACGCCCTTCCAGGCCAACCCGAACCGCCTCCAGAAGGAGGTCATCGCCCTCACTGTGA
CGGGTCAAATATCGCACTTTGGCGAAGAGTTCCTCTTTCCCTTGATCAAGCAGAAATTCCGTTCGTGGTATCGCA
ACTACCGCGATTCGCCCTCCGCAGCCGCGGCGGCTGGTCTGGACCATTTCATCCACGAAGATCAGCCGGAGGAAC
AGGCCCTCCTGACCGCCGCTCGCAACCAGGCGTCCCTTCCGCCGTATGACGTGCAGGCCGACATATCGCAAATGA
CCCTTCAGTTCGGCCACCTCGCACTCTTCAGCCCTGTGTGGCCGCTCATGCCGATCGGGTTCCTGATCAACAACT
GGATCGAGCTGCGCTCCGACTTCCTCAAGATATGCATCGAGCATCAACGGCCACCGCCTTTGCGGGCAGATGGCA
TCGGCCCGTGGGTGCAGAATCTGGGCTTCTTGGCCTGGCTCGGCAGCATCTCGACTGCGGCCATCACGCATCTGT
TTGGGCCAAACGTGGTCGTCTTTGAGAACTCCCTGGTCAGCGGCTGGTGGACCTTACCACTCACCATCGTCATCA
GCGAGCATGTCTTCCTGGCCGTGAGGGCCGTGGTGCAGTCTTTGCTGCATCGGATCGGGTCAGAACAGATCCGCA
AGAAGAGAGATGACAATTACATGCGGAGGAAAAAGCACCTGGACGAGCTGGAGGCAAACAAGAGCGAGATGCTCG
GTCTCGGAGTGGAGCAGAGAGAACGAAGGAAATCTGTCTTGATAACTGCCGGCAACAGCTTTTGGACGAGGCAGG
TCGAGGATGGCAAGAGTAAAGAAGTTGGTGTTCAGCTGATCCAGACCCTCAAAAGGACCAAGAAGGGGGGTGAAA
AAGGAACTGAAAAGGGCAAATTGGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail