Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9270
Gene name
LocationContig_663:5876..8928
Strand-
Gene length (bp)3052
Transcript length (bp)3000
Coding sequence length (bp)3000
Protein length (aa) 1000

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.3E-10 340 457
PF07714 Pkinase_Tyr Protein tyrosine kinase 8.2E-08 337 509

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 347 551 2.0E-08
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 347 551 2.0E-08
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 349 551 7.0E-08
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 339 520 3.0E-07
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 345 551 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 347 551 2.0E-08
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 347 551 2.0E-08
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 349 551 7.0E-08
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 339 520 3.0E-07
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 345 551 1.0E-06
sp|Q86AT8|SPKA_DICDI Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 305 503 4.0E-06
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 287 531 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9270
MALPDGTESEPPSARRAFLRRILGKPSVTPPPPIPMQLPPDVGLDEPAQPPAAAQAARKVVTGLPRSQTFKRQQS
EQRMRLSPITPSADERRATSADRRTQRRAVSQCSADPRASAPGLLGSAHEDGPGLHSRHASTTRASDGPDAQPAV
QLPDDVASRDAHEPALDVDAMGEVQSLTTSQHEAMINDELERTWILNLSMHFRDRSKREKFFVTYREKDHLWRRV
TISLDYRDAPPNSLEMDLMHTRFQREKSAKIYEAIRESLPDIKFYETVTNLKLETTDGRLHVHVVEDGNEIIVYP
RVGQVRHLGCRRVKERDIAFDSHMSGFVYKVCVHGHVLIKKEIPSQDTIEEFLYEVNALNGLRFSRDVVRFYGVV
VDDRDEYVKGLLISYASQGALIDIIYENCKENSFSLPWASKERWARQIIQGLADIHESGFVQGDFTLSNIVIDDA
GDAKIIDINRRGCPVGWEPPEATALLETGHRITMYIGVKSDLYQLGMVLWGLAMEEDEPEMHGRPLMLGPEVDVP
DWYRRMTEICLSGDPRMRMQASSLLQLFPPDTAEDGRPGGLEQAISVDDGHSLSEYFVEGYRADGRPLIRTVEPS
SDWPYSGRTYVDTSPVPYELYYPTRGRSPPSPLPSDLDVCDRSRGPLSKTSWAANRSVRPSYTDVGADESMSDLV
SHGKHEYEHEHEHEHETPTPTAEIKAAGETGDLSMARKPSEPEAAAGGRTGCDGADPADRVRVEKETSDTKSQAV
AHGDDDGSDERWTAAPMPRLTREQTAFLTERPASAVGRGHMCGVTQASGRGSQAAADGDAADATRSHGCRDAGLG
SQPANASGEDDEQVTQQRLRDDVTAGARVAGSDNGRRLPTAGSRDGGGGTEPEPEPEPEPDYVATQAADSTGSGA
RSHRAGGEAAATQTTAGRAANGWTDRGGATEVKRAGAGAQTPERPRQMALPVSLTGVGAAHMGLGDELMREKCIL
DDDFPAMAAPSAVPVVMMTADSPP*
Coding >Hirsu2|9270
ATGGCTCTGCCTGATGGCACCGAGTCCGAGCCACCGTCCGCGAGACGTGCCTTTTTGCGGAGGATCCTGGGCAAG
CCGAGCGTCACGCCGCCACCGCCGATTCCGATGCAGCTGCCTCCGGACGTCGGCCTGGACGAGCCGGCCCAGCCT
CCTGCGGCAGCCCAGGCCGCCAGAAAGGTCGTCACCGGCCTGCCCCGCTCCCAGACGTTCAAGAGACAGCAGTCT
GAGCAGCGGATGCGCCTGTCTCCCATCACGCCCTCGGCCGACGAGCGAAGGGCAACCTCGGCCGACCGCCGCACC
CAACGGCGGGCCGTGTCTCAGTGCAGCGCTGACCCGCGCGCCAGTGCCCCGGGCTTGCTCGGATCCGCTCACGAA
GACGGCCCCGGCCTCCATTCACGCCACGCCTCCACCACCCGGGCGTCCGACGGGCCCGACGCCCAGCCGGCGGTC
CAACTGCCGGACGACGTCGCAAGCAGAGATGCCCACGAGCCGGCTCTGGATGTCGACGCAATGGGCGAGGTTCAG
TCCTTGACGACTTCGCAGCACGAGGCCATGATCAATGACGAGCTGGAGCGGACGTGGATCCTCAACCTCAGCATG
CATTTCCGCGACCGCTCGAAACGGGAAAAGTTCTTCGTCACCTATCGCGAGAAGGACCACCTCTGGCGGCGAGTG
ACCATCTCGCTCGACTACCGCGATGCGCCCCCCAACTCCCTTGAAATGGACCTGATGCACACCCGATTCCAGCGG
GAAAAGAGCGCCAAGATCTACGAGGCCATCCGCGAGAGCCTGCCCGACATCAAGTTCTACGAGACCGTCACCAAC
CTGAAGCTCGAGACGACTGACGGCCGGCTCCACGTCCACGTCGTCGAGGATGGAAATGAAATCATCGTGTACCCT
CGCGTCGGCCAAGTGCGACACCTGGGCTGCCGACGGGTCAAGGAACGCGACATTGCCTTCGACTCGCACATGTCC
GGCTTCGTCTACAAGGTCTGTGTGCACGGGCACGTGCTCATCAAGAAGGAAATCCCCAGCCAGGACACGATTGAG
GAGTTCCTGTACGAGGTCAATGCCCTCAACGGCCTGCGCTTTTCCCGCGACGTGGTGCGCTTCTACGGCGTCGTC
GTCGACGACCGCGACGAATACGTCAAGGGCCTGCTCATCAGCTACGCGTCCCAGGGCGCCCTGATCGACATCATT
TACGAGAATTGCAAAGAAAACAGCTTCAGCCTCCCCTGGGCCAGCAAGGAGCGGTGGGCACGGCAGATCATCCAG
GGCCTGGCCGACATCCACGAGTCGGGCTTCGTCCAGGGCGACTTCACCCTTTCCAACATTGTCATTGACGACGCC
GGCGATGCCAAGATTATAGACATCAACAGGAGGGGCTGTCCCGTGGGCTGGGAGCCGCCCGAGGCGACGGCCCTG
CTCGAGACGGGCCATCGCATCACCATGTACATCGGCGTCAAGTCGGACCTGTACCAGCTGGGCATGGTGCTCTGG
GGCCTGGCGATGGAGGAGGACGAGCCCGAGATGCACGGGCGGCCGCTGATGCTGGGTCCCGAGGTAGACGTGCCC
GACTGGTACCGGCGGATGACGGAGATATGCCTGAGCGGCGATCCGCGCATGCGCATGCAGGCGTCCTCGCTGCTT
CAACTCTTCCCGCCCGACACGGCCGAGGACGGGCGGCCAGGCGGCCTGGAGCAGGCCATCTCGGTCGACGACGGC
CATTCGCTCAGCGAGTATTTCGTGGAGGGGTACCGTGCTGACGGCCGGCCGCTCATCAGGACCGTCGAGCCTTCG
AGCGACTGGCCTTACTCGGGCAGGACCTATGTGGACACGAGCCCGGTGCCGTACGAGCTGTACTATCCGACGCGC
GGGCGGTCGCCCCCGAGCCCCCTGCCGAGCGACCTGGACGTGTGCGACCGTTCGCGAGGACCGCTGAGCAAGACG
TCGTGGGCGGCTAACAGGAGCGTGAGACCGTCGTATACGGACGTAGGGGCGGACGAGTCCATGTCGGACCTGGTG
TCGCATGGCAAGCACGAGTACGAGCACGAGCACGAGCACGAGCACGAGACGCCGACGCCGACGGCGGAGATCAAG
GCGGCCGGCGAGACGGGAGATCTGAGCATGGCGCGAAAGCCGTCGGAGCCCGAGGCTGCTGCAGGCGGCCGCACC
GGCTGTGACGGGGCAGACCCGGCCGACAGGGTCAGGGTCGAGAAAGAGACGAGCGACACGAAGTCGCAGGCTGTC
GCACACGGTGACGATGACGGCTCAGACGAGCGGTGGACGGCAGCGCCGATGCCAAGACTAACTAGAGAACAGACC
GCCTTCCTCACGGAGCGGCCGGCGTCGGCTGTGGGGCGAGGGCACATGTGCGGCGTGACACAGGCCTCAGGCCGA
GGTTCGCAGGCGGCCGCGGACGGTGACGCAGCCGACGCTACACGGAGTCATGGTTGCCGAGATGCGGGGCTGGGG
AGCCAGCCGGCGAACGCGTCGGGCGAAGACGACGAGCAGGTGACGCAGCAGAGGTTACGAGACGACGTGACGGCG
GGGGCACGGGTTGCGGGGTCGGACAACGGGCGACGGCTGCCGACGGCGGGCAGCCGGGACGGCGGCGGAGGGACG
GAGCCGGAGCCGGAGCCGGAGCCGGAACCGGACTACGTGGCGACGCAGGCGGCGGACAGCACAGGATCCGGGGCC
AGGTCGCACAGGGCCGGCGGGGAAGCGGCGGCGACACAGACGACGGCGGGCCGAGCGGCCAACGGCTGGACCGAC
CGAGGCGGCGCGACGGAGGTCAAGAGGGCCGGGGCCGGGGCACAGACGCCGGAGCGGCCGCGGCAGATGGCGCTC
CCGGTGTCGCTGACGGGGGTCGGGGCGGCGCATATGGGGCTCGGCGACGAGCTGATGCGGGAAAAGTGCATCCTC
GACGACGACTTCCCAGCCATGGCGGCGCCGTCTGCGGTGCCGGTTGTGATGATGACGGCAGACTCGCCACCATGA
Transcript >Hirsu2|9270
ATGGCTCTGCCTGATGGCACCGAGTCCGAGCCACCGTCCGCGAGACGTGCCTTTTTGCGGAGGATCCTGGGCAAG
CCGAGCGTCACGCCGCCACCGCCGATTCCGATGCAGCTGCCTCCGGACGTCGGCCTGGACGAGCCGGCCCAGCCT
CCTGCGGCAGCCCAGGCCGCCAGAAAGGTCGTCACCGGCCTGCCCCGCTCCCAGACGTTCAAGAGACAGCAGTCT
GAGCAGCGGATGCGCCTGTCTCCCATCACGCCCTCGGCCGACGAGCGAAGGGCAACCTCGGCCGACCGCCGCACC
CAACGGCGGGCCGTGTCTCAGTGCAGCGCTGACCCGCGCGCCAGTGCCCCGGGCTTGCTCGGATCCGCTCACGAA
GACGGCCCCGGCCTCCATTCACGCCACGCCTCCACCACCCGGGCGTCCGACGGGCCCGACGCCCAGCCGGCGGTC
CAACTGCCGGACGACGTCGCAAGCAGAGATGCCCACGAGCCGGCTCTGGATGTCGACGCAATGGGCGAGGTTCAG
TCCTTGACGACTTCGCAGCACGAGGCCATGATCAATGACGAGCTGGAGCGGACGTGGATCCTCAACCTCAGCATG
CATTTCCGCGACCGCTCGAAACGGGAAAAGTTCTTCGTCACCTATCGCGAGAAGGACCACCTCTGGCGGCGAGTG
ACCATCTCGCTCGACTACCGCGATGCGCCCCCCAACTCCCTTGAAATGGACCTGATGCACACCCGATTCCAGCGG
GAAAAGAGCGCCAAGATCTACGAGGCCATCCGCGAGAGCCTGCCCGACATCAAGTTCTACGAGACCGTCACCAAC
CTGAAGCTCGAGACGACTGACGGCCGGCTCCACGTCCACGTCGTCGAGGATGGAAATGAAATCATCGTGTACCCT
CGCGTCGGCCAAGTGCGACACCTGGGCTGCCGACGGGTCAAGGAACGCGACATTGCCTTCGACTCGCACATGTCC
GGCTTCGTCTACAAGGTCTGTGTGCACGGGCACGTGCTCATCAAGAAGGAAATCCCCAGCCAGGACACGATTGAG
GAGTTCCTGTACGAGGTCAATGCCCTCAACGGCCTGCGCTTTTCCCGCGACGTGGTGCGCTTCTACGGCGTCGTC
GTCGACGACCGCGACGAATACGTCAAGGGCCTGCTCATCAGCTACGCGTCCCAGGGCGCCCTGATCGACATCATT
TACGAGAATTGCAAAGAAAACAGCTTCAGCCTCCCCTGGGCCAGCAAGGAGCGGTGGGCACGGCAGATCATCCAG
GGCCTGGCCGACATCCACGAGTCGGGCTTCGTCCAGGGCGACTTCACCCTTTCCAACATTGTCATTGACGACGCC
GGCGATGCCAAGATTATAGACATCAACAGGAGGGGCTGTCCCGTGGGCTGGGAGCCGCCCGAGGCGACGGCCCTG
CTCGAGACGGGCCATCGCATCACCATGTACATCGGCGTCAAGTCGGACCTGTACCAGCTGGGCATGGTGCTCTGG
GGCCTGGCGATGGAGGAGGACGAGCCCGAGATGCACGGGCGGCCGCTGATGCTGGGTCCCGAGGTAGACGTGCCC
GACTGGTACCGGCGGATGACGGAGATATGCCTGAGCGGCGATCCGCGCATGCGCATGCAGGCGTCCTCGCTGCTT
CAACTCTTCCCGCCCGACACGGCCGAGGACGGGCGGCCAGGCGGCCTGGAGCAGGCCATCTCGGTCGACGACGGC
CATTCGCTCAGCGAGTATTTCGTGGAGGGGTACCGTGCTGACGGCCGGCCGCTCATCAGGACCGTCGAGCCTTCG
AGCGACTGGCCTTACTCGGGCAGGACCTATGTGGACACGAGCCCGGTGCCGTACGAGCTGTACTATCCGACGCGC
GGGCGGTCGCCCCCGAGCCCCCTGCCGAGCGACCTGGACGTGTGCGACCGTTCGCGAGGACCGCTGAGCAAGACG
TCGTGGGCGGCTAACAGGAGCGTGAGACCGTCGTATACGGACGTAGGGGCGGACGAGTCCATGTCGGACCTGGTG
TCGCATGGCAAGCACGAGTACGAGCACGAGCACGAGCACGAGCACGAGACGCCGACGCCGACGGCGGAGATCAAG
GCGGCCGGCGAGACGGGAGATCTGAGCATGGCGCGAAAGCCGTCGGAGCCCGAGGCTGCTGCAGGCGGCCGCACC
GGCTGTGACGGGGCAGACCCGGCCGACAGGGTCAGGGTCGAGAAAGAGACGAGCGACACGAAGTCGCAGGCTGTC
GCACACGGTGACGATGACGGCTCAGACGAGCGGTGGACGGCAGCGCCGATGCCAAGACTAACTAGAGAACAGACC
GCCTTCCTCACGGAGCGGCCGGCGTCGGCTGTGGGGCGAGGGCACATGTGCGGCGTGACACAGGCCTCAGGCCGA
GGTTCGCAGGCGGCCGCGGACGGTGACGCAGCCGACGCTACACGGAGTCATGGTTGCCGAGATGCGGGGCTGGGG
AGCCAGCCGGCGAACGCGTCGGGCGAAGACGACGAGCAGGTGACGCAGCAGAGGTTACGAGACGACGTGACGGCG
GGGGCACGGGTTGCGGGGTCGGACAACGGGCGACGGCTGCCGACGGCGGGCAGCCGGGACGGCGGCGGAGGGACG
GAGCCGGAGCCGGAGCCGGAGCCGGAACCGGACTACGTGGCGACGCAGGCGGCGGACAGCACAGGATCCGGGGCC
AGGTCGCACAGGGCCGGCGGGGAAGCGGCGGCGACACAGACGACGGCGGGCCGAGCGGCCAACGGCTGGACCGAC
CGAGGCGGCGCGACGGAGGTCAAGAGGGCCGGGGCCGGGGCACAGACGCCGGAGCGGCCGCGGCAGATGGCGCTC
CCGGTGTCGCTGACGGGGGTCGGGGCGGCGCATATGGGGCTCGGCGACGAGCTGATGCGGGAAAAGTGCATCCTC
GACGACGACTTCCCAGCCATGGCGGCGCCGTCTGCGGTGCCGGTTGTGATGATGACGGCAGACTCGCCACCATGA
Gene >Hirsu2|9270
ATGGCTCTGCCTGATGGCACCGAGTCCGAGCCACCGTCCGCGAGACGTGCCTTTTTGCGGAGGATCCTGGGCAAG
CCGAGCGTCACGCCGCCACCGCCGATTCCGATGCAGCTGCCTCCGGACGTCGGCCTGGACGAGCCGGCCCAGCCT
CCTGCGGCAGCCCAGGCCGCCAGAAAGGTCGTCACCGGCCTGCCCCGCTCCCAGACGTTCAAGAGACAGCAGTCT
GAGCAGCGGATGCGCCTGTCTCCCATCACGCCCTCGGCCGACGAGCGAAGGGCAACCTCGGCCGACCGCCGCACC
CAACGGCGGGCCGTGTCTCAGTGCAGCGCTGACCCGCGCGCCAGTGCCCCGGGCTTGCTCGGATCCGCTCACGAA
GACGGCCCCGGCCTCCATTCACGCCACGCCTCCACCACCCGGGCGTCCGACGGGCCCGACGCCCAGCCGGCGGTC
CAACTGCCGGACGACGTCGCAAGCAGAGATGCCCACGAGCCGGCTCTGGATGTCGACGCAATGGGCGAGGTTCAG
TCCTTGACGACTTCGCAGCACGAGGCCATGATCAATGACGAGCTGGAGCGGACGTGGATCCTCAACCTCAGCATG
CATTTCCGCGACCGCTCGAAACGGGAAAAGTTCTTCGTCACCTATCGCGAGAAGGACCACCTCTGGCGGCGAGTG
ACCATCTCGCTCGACTACCGCGATGCGCCCCCCAACTCCCTTGAAATGGACCTGATGCACACCCGATTCCAGCGG
GAAAAGAGCGCCAAGATCTACGAGGCCATCCGCGAGAGCCTGCCCGACATCAAGTTCTACGAGACCGTCACCAAC
CTGAAGCTCGAGACGACTGACGGCCGGCTCCACGTCCACGTCGTCGAGGATGGAAATGTGAGCCGAGACTGATGC
TTCCCCCGACCCAGACTAATTGACCCTGGCCTAGGAAATCATCGTGTACCCTCGCGTCGGCCAAGTGCGACACCT
GGGCTGCCGACGGGTCAAGGAACGCGACATTGCCTTCGACTCGCACATGTCCGGCTTCGTCTACAAGGTCTGTGT
GCACGGGCACGTGCTCATCAAGAAGGAAATCCCCAGCCAGGACACGATTGAGGAGTTCCTGTACGAGGTCAATGC
CCTCAACGGCCTGCGCTTTTCCCGCGACGTGGTGCGCTTCTACGGCGTCGTCGTCGACGACCGCGACGAATACGT
CAAGGGCCTGCTCATCAGCTACGCGTCCCAGGGCGCCCTGATCGACATCATTTACGAGAATTGCAAAGAAAACAG
CTTCAGCCTCCCCTGGGCCAGCAAGGAGCGGTGGGCACGGCAGATCATCCAGGGCCTGGCCGACATCCACGAGTC
GGGCTTCGTCCAGGGCGACTTCACCCTTTCCAACATTGTCATTGACGACGCCGGCGATGCCAAGATTATAGACAT
CAACAGGAGGGGCTGTCCCGTGGGCTGGGAGCCGCCCGAGGCGACGGCCCTGCTCGAGACGGGCCATCGCATCAC
CATGTACATCGGCGTCAAGTCGGACCTGTACCAGCTGGGCATGGTGCTCTGGGGCCTGGCGATGGAGGAGGACGA
GCCCGAGATGCACGGGCGGCCGCTGATGCTGGGTCCCGAGGTAGACGTGCCCGACTGGTACCGGCGGATGACGGA
GATATGCCTGAGCGGCGATCCGCGCATGCGCATGCAGGCGTCCTCGCTGCTTCAACTCTTCCCGCCCGACACGGC
CGAGGACGGGCGGCCAGGCGGCCTGGAGCAGGCCATCTCGGTCGACGACGGCCATTCGCTCAGCGAGTATTTCGT
GGAGGGGTACCGTGCTGACGGCCGGCCGCTCATCAGGACCGTCGAGCCTTCGAGCGACTGGCCTTACTCGGGCAG
GACCTATGTGGACACGAGCCCGGTGCCGTACGAGCTGTACTATCCGACGCGCGGGCGGTCGCCCCCGAGCCCCCT
GCCGAGCGACCTGGACGTGTGCGACCGTTCGCGAGGACCGCTGAGCAAGACGTCGTGGGCGGCTAACAGGAGCGT
GAGACCGTCGTATACGGACGTAGGGGCGGACGAGTCCATGTCGGACCTGGTGTCGCATGGCAAGCACGAGTACGA
GCACGAGCACGAGCACGAGCACGAGACGCCGACGCCGACGGCGGAGATCAAGGCGGCCGGCGAGACGGGAGATCT
GAGCATGGCGCGAAAGCCGTCGGAGCCCGAGGCTGCTGCAGGCGGCCGCACCGGCTGTGACGGGGCAGACCCGGC
CGACAGGGTCAGGGTCGAGAAAGAGACGAGCGACACGAAGTCGCAGGCTGTCGCACACGGTGACGATGACGGCTC
AGACGAGCGGTGGACGGCAGCGCCGATGCCAAGACTAACTAGAGAACAGACCGCCTTCCTCACGGAGCGGCCGGC
GTCGGCTGTGGGGCGAGGGCACATGTGCGGCGTGACACAGGCCTCAGGCCGAGGTTCGCAGGCGGCCGCGGACGG
TGACGCAGCCGACGCTACACGGAGTCATGGTTGCCGAGATGCGGGGCTGGGGAGCCAGCCGGCGAACGCGTCGGG
CGAAGACGACGAGCAGGTGACGCAGCAGAGGTTACGAGACGACGTGACGGCGGGGGCACGGGTTGCGGGGTCGGA
CAACGGGCGACGGCTGCCGACGGCGGGCAGCCGGGACGGCGGCGGAGGGACGGAGCCGGAGCCGGAGCCGGAGCC
GGAACCGGACTACGTGGCGACGCAGGCGGCGGACAGCACAGGATCCGGGGCCAGGTCGCACAGGGCCGGCGGGGA
AGCGGCGGCGACACAGACGACGGCGGGCCGAGCGGCCAACGGCTGGACCGACCGAGGCGGCGCGACGGAGGTCAA
GAGGGCCGGGGCCGGGGCACAGACGCCGGAGCGGCCGCGGCAGATGGCGCTCCCGGTGTCGCTGACGGGGGTCGG
GGCGGCGCATATGGGGCTCGGCGACGAGCTGATGCGGGAAAAGTGCATCCTCGACGACGACTTCCCAGCCATGGC
GGCGCCGTCTGCGGTGCCGGTTGTGATGATGACGGCAGACTCGCCACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail