Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9268
Gene name
LocationContig_662:13723..14480
Strand+
Gene length (bp)757
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 4.0E-07 159 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 121 200 6.0E-12
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 135 200 5.0E-11
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 147 199 6.0E-10
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 147 200 6.0E-09
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 136 197 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 121 200 6.0E-12
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 135 200 5.0E-11
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 147 199 6.0E-10
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 147 200 6.0E-09
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 136 197 2.0E-08
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 151 200 4.0E-08
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 147 200 5.0E-08
sp|P0CK99|AROP_SALTY Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroP PE=3 SV=1 150 199 2.0E-07
sp|E1W822|AROP_SALTS Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain SL1344) GN=aroP PE=3 SV=1 150 199 2.0E-07
sp|P0A188|AROP_SALTI Aromatic amino acid transport protein AroP OS=Salmonella typhi GN=aroP PE=3 SV=1 150 199 2.0E-07
sp|Q8FL49|AROP_ECOL6 Aromatic amino acid transport protein AroP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroP PE=3 SV=1 150 199 2.0E-07
sp|P59737|AROP_SHIFL Aromatic amino acid transport protein AroP OS=Shigella flexneri GN=aroP PE=3 SV=1 150 199 2.0E-07
sp|P15993|AROP_ECOLI Aromatic amino acid transport protein AroP OS=Escherichia coli (strain K12) GN=aroP PE=1 SV=3 150 199 2.0E-07
sp|Q8X968|AROP_ECO57 Aromatic amino acid transport protein AroP OS=Escherichia coli O157:H7 GN=aroP PE=3 SV=1 150 199 2.0E-07
sp|P39137|ROCE_BACSU Amino-acid permease RocE OS=Bacillus subtilis (strain 168) GN=rocE PE=2 SV=1 149 200 2.0E-07
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 136 199 3.0E-07
sp|P38967|TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT2 PE=1 SV=1 150 197 5.0E-07
sp|O06005|AAPA_BACSU Amino-acid permease AapA OS=Bacillus subtilis (strain 168) GN=aapA PE=3 SV=2 147 198 6.0E-07
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 140 200 1.0E-06
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 140 200 1.0E-06
sp|P39636|ROCC_BACSU Amino-acid permease RocC OS=Bacillus subtilis (strain 168) GN=rocC PE=2 SV=1 147 193 1.0E-06
sp|Q876K6|AGP1_SACU7 General amino acid permease AGP1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AGP1 PE=3 SV=1 95 200 1.0E-06
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 139 200 2.0E-06
sp|A6ZTG5|AGP1_YEAS7 General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AGP1 PE=3 SV=1 73 200 4.0E-06
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 151 199 5.0E-06
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 151 200 8.0E-06
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 147 200 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 159 181 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9268
MRASGSAESASSGSRTLGLPSSPSRRAADRDEAIAAEAIEEAAAAADAEKRSADESAAMRGYGGTGITKKGLFDD
SSDRGGRGGDGDVEVGVEGQQQQQRKRLRLLAFWSSPSSPRASSSAEETTAAAAAAAASSDGNSDEVVTAAEDRD
LRRGLAERHVSMMGIAGAIGTGLFLGLGAAVRRAGPLGALLGYGTVGLVV*
Coding >Hirsu2|9268
ATGAGGGCGAGCGGCTCGGCCGAGAGCGCCAGCTCGGGCTCCCGCACCCTCGGGCTTCCGTCGTCGCCGTCCCGC
CGCGCCGCCGACCGAGACGAGGCCATCGCGGCGGAGGCAATCGAGGAGGCGGCAGCAGCAGCAGACGCGGAGAAG
CGGTCGGCAGACGAGTCGGCGGCCATGCGCGGCTACGGCGGCACCGGCATCACCAAGAAGGGCCTGTTTGACGAT
TCGTCGGACCGCGGCGGGCGGGGGGGCGACGGCGATGTCGAGGTCGGCGTCGAGGGACAGCAGCAGCAGCAGCGG
AAACGGCTCCGGCTCCTGGCCTTCTGGTCCTCCCCCTCCTCGCCTCGCGCGTCCTCGTCGGCAGAAGAGACGACG
GCGGCGGCGGCAGCAGCAGCAGCATCCAGCGACGGCAACTCGGACGAGGTGGTGACGGCGGCCGAGGACCGGGAC
CTGCGGCGCGGGCTGGCGGAGCGGCACGTGTCGATGATGGGCATCGCCGGCGCCATCGGCACCGGCCTCTTCCTC
GGGCTCGGGGCGGCGGTGCGGCGGGCGGGCCCGCTGGGCGCGCTGCTGGGCTACGGCACCGTCGGGCTGGTGGTC
TGA
Transcript >Hirsu2|9268
ATGAGGGCGAGCGGCTCGGCCGAGAGCGCCAGCTCGGGCTCCCGCACCCTCGGGCTTCCGTCGTCGCCGTCCCGC
CGCGCCGCCGACCGAGACGAGGCCATCGCGGCGGAGGCAATCGAGGAGGCGGCAGCAGCAGCAGACGCGGAGAAG
CGGTCGGCAGACGAGTCGGCGGCCATGCGCGGCTACGGCGGCACCGGCATCACCAAGAAGGGCCTGTTTGACGAT
TCGTCGGACCGCGGCGGGCGGGGGGGCGACGGCGATGTCGAGGTCGGCGTCGAGGGACAGCAGCAGCAGCAGCGG
AAACGGCTCCGGCTCCTGGCCTTCTGGTCCTCCCCCTCCTCGCCTCGCGCGTCCTCGTCGGCAGAAGAGACGACG
GCGGCGGCGGCAGCAGCAGCAGCATCCAGCGACGGCAACTCGGACGAGGTGGTGACGGCGGCCGAGGACCGGGAC
CTGCGGCGCGGGCTGGCGGAGCGGCACGTGTCGATGATGGGCATCGCCGGCGCCATCGGCACCGGCCTCTTCCTC
GGGCTCGGGGCGGCGGTGCGGCGGGCGGGCCCGCTGGGCGCGCTGCTGGGCTACGGCACCGTCGGGCTGGTGGTC
TGA
Gene >Hirsu2|9268
ATGAGGGCGAGCGGCTCGGCCGAGAGCGCCAGCTCGGGCTCCCGCACCCTCGGGCTTCCGTCGTCGCCGTCCCGC
CGCGCCGCCGACCGAGACGAGGCCATCGCGGCGGAGGCAATCGAGGAGGCGGCAGCAGCAGCAGACGCGGAGAAG
CGGTCGGCAGACGAGTCGGCGGCCATGCGCGGCTACGGCGGCACCGGCATCACCAAGAAGGGCCTGTTTGACGAT
TCGTCGGACCGCGGCGGGCGGGGGGGCGACGGCGATGTCGAGGTCGGCGTCGAGGGACAGCAGCAGCAGCAGCGG
AAACGGCTCCGGCTCCTGGCCTTCTGGTCCTCCCCCTCCTCGCCTCGCGCGTCCTCGTCGGCAGAAGAGACGACG
GCGGCGGCGGCAGCAGCAGCAGCATCCAGCGACGGCAACTCGGACGAGGTGGTGACGGCGGCCGAGGACCGGGAC
CTGCGGCGCGGGCTGGCGGAGCGGCACGTGTCGATGATGGGCATCGCCGGCGCCATCGGCACCGGCCTCTTCCTC
GGGCTCGGGGCGGCGGTGCGGCGGGCGGGCCCGCTGGGCGCGCTGCTGGGCTACGGCACCGTCGGGCTGGTGGTG
TGCGCGGTGCAGCTGGCGCTGGGCGAGGCGGCGGCGCTGCTGCCCGTCACCGGCGGCTTCGTCCGGCACGCGGAC
CTGCTGGTGGACCCGGCCTGGGGCTTCGCCGTCGGCTGGAACCTGGTGTACGGCAACGCGCTGTCGATCCCGTCC
GAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail