Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9256
Gene name
LocationContig_660:13720..14527
Strand-
Gene length (bp)807
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain 1.0E-48 3 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RY79|TYDC1_ARATH Tyrosine decarboxylase 1 OS=Arabidopsis thaliana GN=ELI5 PE=2 SV=1 5 258 1.0E-59
sp|Q7XHL3|TYDC1_ORYSJ Tyrosine decarboxylase 1 OS=Oryza sativa subsp. japonica GN=Os07g0437500 PE=2 SV=1 3 259 2.0E-59
sp|P54768|TYDC1_PAPSO Tyrosine/DOPA decarboxylase 1 OS=Papaver somniferum GN=TYDC1 PE=2 SV=1 5 264 2.0E-55
sp|P54771|TYDC5_PAPSO Tyrosine/DOPA decarboxylase 5 OS=Papaver somniferum GN=TYDC5 PE=2 SV=1 5 267 3.0E-55
sp|P14173|DDC_RAT Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus GN=Ddc PE=1 SV=1 3 263 3.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RY79|TYDC1_ARATH Tyrosine decarboxylase 1 OS=Arabidopsis thaliana GN=ELI5 PE=2 SV=1 5 258 1.0E-59
sp|Q7XHL3|TYDC1_ORYSJ Tyrosine decarboxylase 1 OS=Oryza sativa subsp. japonica GN=Os07g0437500 PE=2 SV=1 3 259 2.0E-59
sp|P54768|TYDC1_PAPSO Tyrosine/DOPA decarboxylase 1 OS=Papaver somniferum GN=TYDC1 PE=2 SV=1 5 264 2.0E-55
sp|P54771|TYDC5_PAPSO Tyrosine/DOPA decarboxylase 5 OS=Papaver somniferum GN=TYDC5 PE=2 SV=1 5 267 3.0E-55
sp|P14173|DDC_RAT Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus GN=Ddc PE=1 SV=1 3 263 3.0E-53
sp|P22781|DDC_CAVPO Aromatic-L-amino-acid decarboxylase OS=Cavia porcellus GN=DDC PE=2 SV=1 3 258 4.0E-53
sp|P27718|DDC_BOVIN Aromatic-L-amino-acid decarboxylase OS=Bos taurus GN=DDC PE=2 SV=2 3 266 6.0E-53
sp|P20711|DDC_HUMAN Aromatic-L-amino-acid decarboxylase OS=Homo sapiens GN=DDC PE=1 SV=2 3 260 1.0E-52
sp|O88533|DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus GN=Ddc PE=1 SV=1 3 263 3.0E-52
sp|P54770|TYDC3_PAPSO Tyrosine/DOPA decarboxylase 3 OS=Papaver somniferum GN=TYDC3 PE=2 SV=2 5 265 4.0E-50
sp|P48861|DDC_MANSE Aromatic-L-amino-acid decarboxylase OS=Manduca sexta GN=Ddc PE=2 SV=1 4 260 1.0E-49
sp|Q9M0G4|TYDC2_ARATH Probable tyrosine decarboxylase 2 OS=Arabidopsis thaliana GN=At4g28680 PE=2 SV=1 3 254 1.0E-49
sp|P54769|TYDC2_PAPSO Tyrosine/DOPA decarboxylase 2 OS=Papaver somniferum GN=TYDC2 PE=2 SV=1 5 265 3.0E-49
sp|Q95ZS2|TDC1_CAEEL Tyrosine decarboxylase OS=Caenorhabditis elegans GN=tdc-1 PE=2 SV=1 5 258 1.0E-48
sp|P80041|DDC_PIG Aromatic-L-amino-acid decarboxylase OS=Sus scrofa GN=DDC PE=1 SV=2 3 250 2.0E-48
sp|P17770|DDC_CATRO Aromatic-L-amino-acid decarboxylase OS=Catharanthus roseus GN=TDC PE=2 SV=1 2 253 4.0E-47
sp|Q06088|TYDC4_PETCR Tyrosine decarboxylase 4 OS=Petroselinum crispum GN=TYRDC-4 PE=2 SV=1 4 258 5.0E-47
sp|Q06086|TYDC2_PETCR Tyrosine decarboxylase 2 OS=Petroselinum crispum GN=TYRDC-2 PE=2 SV=1 4 258 6.0E-47
sp|Q06087|TYDC3_PETCR Tyrosine decarboxylase 3 OS=Petroselinum crispum GN=TYRDC-3 PE=2 SV=1 4 258 2.0E-46
sp|O96571|DDC_DROLE Aromatic-L-amino-acid decarboxylase (Fragment) OS=Drosophila lebanonensis GN=Ddc PE=3 SV=1 3 250 6.0E-45
sp|P23738|DCHS_MOUSE Histidine decarboxylase OS=Mus musculus GN=Hdc PE=1 SV=2 4 268 1.0E-44
sp|Q5EA83|DCHS_BOVIN Histidine decarboxylase OS=Bos taurus GN=HDC PE=2 SV=1 4 241 4.0E-43
sp|P05031|DDC_DROME Aromatic-L-amino-acid decarboxylase OS=Drosophila melanogaster GN=Ddc PE=1 SV=4 3 250 1.0E-42
sp|O96567|DDC_DROSI Aromatic-L-amino-acid decarboxylase OS=Drosophila simulans GN=Ddc PE=3 SV=2 3 250 1.0E-42
sp|P16453|DCHS_RAT Histidine decarboxylase OS=Rattus norvegicus GN=Hdc PE=2 SV=2 4 268 3.0E-42
sp|P19113|DCHS_HUMAN Histidine decarboxylase OS=Homo sapiens GN=HDC PE=1 SV=2 4 241 3.0E-42
sp|Q05733|DCHS_DROME Histidine decarboxylase OS=Drosophila melanogaster GN=Hdc PE=2 SV=2 4 230 3.0E-41
sp|P18486|L2AM_DROME Alpha-methyldopa hypersensitive protein OS=Drosophila melanogaster GN=amd PE=2 SV=2 3 260 1.0E-40
sp|O96569|L2AM_DROLE Alpha-methyldopa hypersensitive protein (Fragment) OS=Drosophila lebanonensis GN=amd PE=3 SV=1 5 262 2.0E-40
sp|Q06085|TYDC1_PETCR Tyrosine decarboxylase 1 (Fragment) OS=Petroselinum crispum GN=TYRDC-1 PE=2 SV=1 4 195 6.0E-40
sp|P81893|L2AM_DROSI Alpha-methyldopa hypersensitive protein (Fragment) OS=Drosophila simulans GN=amd PE=2 SV=1 3 187 1.0E-38
sp|Q99259|DCE1_HUMAN Glutamate decarboxylase 1 OS=Homo sapiens GN=GAD1 PE=1 SV=1 4 208 5.0E-20
sp|Q5R7S7|DCE1_PONAB Glutamate decarboxylase 1 OS=Pongo abelii GN=GAD1 PE=2 SV=1 4 208 5.0E-20
sp|Q5IS68|DCE1_PANTR Glutamate decarboxylase 1 OS=Pan troglodytes GN=GAD1 PE=2 SV=1 4 208 1.0E-19
sp|Q0VCA1|DCE1_BOVIN Glutamate decarboxylase 1 OS=Bos taurus GN=GAD1 PE=2 SV=1 4 208 1.0E-19
sp|P71362|DDC_HAEIN L-2,4-diaminobutyrate decarboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ddc PE=1 SV=1 11 257 2.0E-19
sp|P18088|DCE1_RAT Glutamate decarboxylase 1 OS=Rattus norvegicus GN=Gad1 PE=2 SV=1 4 208 2.0E-19
sp|P14748|DCE1_FELCA Glutamate decarboxylase 1 OS=Felis catus GN=GAD1 PE=2 SV=3 4 208 5.0E-19
sp|A0PA85|DCE1_CANLF Glutamate decarboxylase 1 OS=Canis lupus familiaris GN=GAD1 PE=2 SV=1 4 208 5.0E-19
sp|P48319|DCE1_PIG Glutamate decarboxylase 1 OS=Sus scrofa GN=GAD1 PE=2 SV=1 4 208 9.0E-19
sp|P48318|DCE1_MOUSE Glutamate decarboxylase 1 OS=Mus musculus GN=Gad1 PE=1 SV=2 4 208 1.0E-18
sp|Q64611|CSAD_RAT Cysteine sulfinic acid decarboxylase OS=Rattus norvegicus GN=Csad PE=1 SV=1 3 204 2.0E-18
sp|Q9DBE0|CSAD_MOUSE Cysteine sulfinic acid decarboxylase OS=Mus musculus GN=Csad PE=1 SV=1 3 204 5.0E-18
sp|Q9Y600|CSAD_HUMAN Cysteine sulfinic acid decarboxylase OS=Homo sapiens GN=CSAD PE=1 SV=2 3 181 2.0E-17
sp|Q80WP8|GADL1_MOUSE Acidic amino acid decarboxylase GADL1 OS=Mus musculus GN=Gadl1 PE=1 SV=3 4 181 2.0E-17
sp|Q05683|DCE2_RAT Glutamate decarboxylase 2 OS=Rattus norvegicus GN=Gad2 PE=1 SV=1 4 204 5.0E-17
sp|Q4PRC2|DCE2_CANLF Glutamate decarboxylase 2 OS=Canis lupus familiaris GN=GAD2 PE=2 SV=1 4 204 5.0E-17
sp|P34751|DDC_CAEEL Probable aromatic-L-amino-acid decarboxylase OS=Caenorhabditis elegans GN=hdl-1 PE=2 SV=3 4 248 7.0E-17
sp|P48320|DCE2_MOUSE Glutamate decarboxylase 2 OS=Mus musculus GN=Gad2 PE=1 SV=1 4 208 9.0E-17
sp|Q6ZQY3|GADL1_HUMAN Acidic amino acid decarboxylase GADL1 OS=Homo sapiens GN=GADL1 PE=1 SV=4 4 181 1.0E-16
sp|Q05329|DCE2_HUMAN Glutamate decarboxylase 2 OS=Homo sapiens GN=GAD2 PE=1 SV=1 4 208 1.0E-16
sp|P48321|DCE2_PIG Glutamate decarboxylase 2 OS=Sus scrofa GN=GAD2 PE=2 SV=1 4 179 4.0E-16
sp|A6QM00|GADL1_BOVIN Acidic amino acid decarboxylase GADL1 OS=Bos taurus GN=GADL1 PE=2 SV=2 4 181 9.0E-16
sp|Q43908|DDC_ACIBA L-2,4-diaminobutyrate decarboxylase OS=Acinetobacter baumannii GN=ddc PE=1 SV=1 1 268 4.0E-15
sp|Q28D99|GADL1_XENTR Acidic amino acid decarboxylase GADL1 (Fragment) OS=Xenopus tropicalis GN=gadl1 PE=2 SV=2 4 181 4.0E-15
sp|P20228|DCE_DROME Glutamate decarboxylase OS=Drosophila melanogaster GN=Gad1 PE=2 SV=2 3 197 2.0E-14
sp|Q9Z3R1|RHBB_RHIME L-2,4-diaminobutyrate decarboxylase OS=Rhizobium meliloti (strain 1021) GN=rhbB PE=3 SV=1 1 147 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016831 carboxy-lyase activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0019752 carboxylic acid metabolic process Yes
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0016829 lyase activity No
GO:0008152 metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0006082 organic acid metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0070279 vitamin B6 binding No
GO:0019842 vitamin binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0044281 small molecule metabolic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9256
LAARGLEPFYLTATLGSTDVCAVDDLDGIAAALAPRAATPRDVWVHVDAAYAGAALVLDEHRPLADAAGRFRSFN
FNPHKWLFTTFDCSALFVRRRDDLIEALSVQPPYLRNAASDAGAVVDFRDWQIALGRRFRSLKLWAVLRAFGARA
LRDHVRLGIRLAEALEARLRARSDLFAVFTPARFALVTLRLRADADDRPGRRTQRLHRDLDARGDFFLTATVVDG
RFAIRVCTAGAAVRDEHVQSLFEQLVERAEAVLAAPDDDDAAP*
Coding >Hirsu2|9256
CTGGCCGCCCGCGGCCTCGAGCCCTTCTACCTGACGGCCACGCTCGGCTCGACCGACGTGTGCGCCGTCGACGAC
TTGGACGGCATCGCCGCCGCGCTGGCCCCGCGCGCCGCCACCCCGCGCGACGTTTGGGTCCACGTCGACGCCGCC
TACGCCGGCGCCGCCCTCGTCCTCGACGAGCACCGCCCCCTGGCCGACGCCGCCGGCCGCTTCCGCTCCTTCAAC
TTCAACCCGCACAAGTGGCTCTTTACCACCTTCGACTGCTCCGCCCTCTTCGTCCGCCGCCGCGACGACCTGATC
GAGGCGCTGAGCGTCCAGCCGCCGTACCTGCGCAACGCCGCCTCCGACGCCGGCGCCGTCGTCGACTTCCGCGAC
TGGCAGATCGCCCTCGGCCGCCGCTTCCGCTCCCTCAAGCTGTGGGCCGTCCTGCGCGCCTTTGGCGCCCGCGCC
CTGCGCGACCACGTCCGCCTCGGTATCCGCCTCGCCGAGGCCCTCGAGGCCCGCCTGCGCGCCCGCTCGGACCTC
TTCGCCGTCTTCACCCCGGCCCGCTTCGCCCTCGTCACCCTGCGCCTGCGCGCCGACGCCGACGACCGCCCCGGC
CGCCGCACCCAGCGCCTCCATCGCGACCTCGACGCCCGCGGCGACTTCTTCCTCACCGCCACCGTTGTCGACGGC
CGCTTCGCCATCCGCGTCTGCACCGCCGGCGCCGCCGTCCGCGACGAGCACGTCCAGAGCCTCTTCGAACAGCTC
GTCGAGCGCGCCGAGGCCGTCCTGGCCGCCCCTGACGACGACGATGCCGCGCCCTAG
Transcript >Hirsu2|9256
CTGGCCGCCCGCGGCCTCGAGCCCTTCTACCTGACGGCCACGCTCGGCTCGACCGACGTGTGCGCCGTCGACGAC
TTGGACGGCATCGCCGCCGCGCTGGCCCCGCGCGCCGCCACCCCGCGCGACGTTTGGGTCCACGTCGACGCCGCC
TACGCCGGCGCCGCCCTCGTCCTCGACGAGCACCGCCCCCTGGCCGACGCCGCCGGCCGCTTCCGCTCCTTCAAC
TTCAACCCGCACAAGTGGCTCTTTACCACCTTCGACTGCTCCGCCCTCTTCGTCCGCCGCCGCGACGACCTGATC
GAGGCGCTGAGCGTCCAGCCGCCGTACCTGCGCAACGCCGCCTCCGACGCCGGCGCCGTCGTCGACTTCCGCGAC
TGGCAGATCGCCCTCGGCCGCCGCTTCCGCTCCCTCAAGCTGTGGGCCGTCCTGCGCGCCTTTGGCGCCCGCGCC
CTGCGCGACCACGTCCGCCTCGGTATCCGCCTCGCCGAGGCCCTCGAGGCCCGCCTGCGCGCCCGCTCGGACCTC
TTCGCCGTCTTCACCCCGGCCCGCTTCGCCCTCGTCACCCTGCGCCTGCGCGCCGACGCCGACGACCGCCCCGGC
CGCCGCACCCAGCGCCTCCATCGCGACCTCGACGCCCGCGGCGACTTCTTCCTCACCGCCACCGTTGTCGACGGC
CGCTTCGCCATCCGCGTCTGCACCGCCGGCGCCGCCGTCCGCGACGAGCACGTCCAGAGCCTCTTCGAACAGCTC
GTCGAGCGCGCCGAGGCCGTCCTGGCCGCCCCTGACGACGACGATGCCGCGCCCTAG
Gene >Hirsu2|9256
CTGGCCGCCCGCGGCCTCGAGCCCTTCTACCTGACGGCCACGCTCGGCTCGACCGACGTGTGCGCCGTCGACGAC
TTGGACGGCATCGCCGCCGCGCTGGCCCCGCGCGCCGCCACCCCGCGCGACGTTTGGGTCCACGTCGACGCCGCC
TACGCCGGCGCCGCCCTCGTCCTCGACGAGCACCGCCCCCTGGCCGACGCCGCCGGCCGCTTCCGCTCCTTCAAC
TTCAACCCGCACAAGTGGCTCTTTACCACCTTCGACTGCTCCGCCCTCTTCGTCCGCCGCCGCGACGACCTGATC
GAGGCGCTGAGCGTCCAGCCGCCGTACCTGCGCAACGCCGCCTCCGACGCCGGCGCCGTCGTCGACTTCCGCGAC
TGGCAGATCGCCCTCGGCCGCCGCTTCCGCTCCCTCAAGCTGTGGGCCGTCCTGCGCGCCTTTGGCGCCCGCGCC
CTGCGCGACCACGTCCGCCTCGGTATCCGCCTCGCCGAGGCCCTCGAGGCCCGCCTGCGCGCCCGCTCGGACCTC
TTCGCCGTCTTCACCCCGGCCCGCTTCGCCCTCGTCACCCTGCGCCTGCGCGCCGACGCCGACGACCGCCCCGGC
CGCCGCACCCAGCGCCTCCATCGCGACCTCGACGCCCGCGGCGACTTCTTCCTCACCGCCACCGTTGTCGACGGC
CGCTTCGCCATCCGCGTCTGCACCGCCGGCGCCGCCGTCCGCGACGAGCACGTCCAGAGCCTCTTCGAACAGCTC
GTCGAGCGCGCCGAGGCCGTCCTGGCCGCCCCTGACGACGACGATGCCGCGCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail