Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9255
Gene name
LocationContig_660:8489..13291
Strand+
Gene length (bp)4802
Transcript length (bp)4254
Coding sequence length (bp)4254
Protein length (aa) 1418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00027 cNMP_binding Cyclic nucleotide-binding domain 2.3E-16 754 841
PF01734 Patatin Patatin-like phospholipase 9.0E-16 1114 1274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0D3|NTE1_CHAGB Lysophospholipase NTE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NTE1 PE=3 SV=2 46 1417 0.0E+00
sp|Q7S8J1|NTE1_NEUCR Lysophospholipase nte1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nte1 PE=3 SV=2 31 1417 0.0E+00
sp|A4QVZ8|NTE1_MAGO7 Lysophospholipase NTE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NTE1 PE=3 SV=2 40 1417 0.0E+00
sp|Q4WA15|NTE1_ASPFU Lysophospholipase nte1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nte1 PE=3 SV=1 47 1417 0.0E+00
sp|A1D9Y2|NTE1_NEOFI Lysophospholipase nte1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nte1 PE=3 SV=2 47 1417 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H0D3|NTE1_CHAGB Lysophospholipase NTE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NTE1 PE=3 SV=2 46 1417 0.0E+00
sp|Q7S8J1|NTE1_NEUCR Lysophospholipase nte1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nte1 PE=3 SV=2 31 1417 0.0E+00
sp|A4QVZ8|NTE1_MAGO7 Lysophospholipase NTE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NTE1 PE=3 SV=2 40 1417 0.0E+00
sp|Q4WA15|NTE1_ASPFU Lysophospholipase nte1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nte1 PE=3 SV=1 47 1417 0.0E+00
sp|A1D9Y2|NTE1_NEOFI Lysophospholipase nte1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nte1 PE=3 SV=2 47 1417 0.0E+00
sp|A2R350|NTE1_ASPNC Lysophospholipase nte1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nte1 PE=3 SV=2 48 1417 0.0E+00
sp|Q5BAE9|NTE1_EMENI Lysophospholipase nte1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nte1 PE=3 SV=2 48 1417 0.0E+00
sp|Q0CNC7|NTE1_ASPTN Lysophospholipase nte1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nte1 PE=3 SV=1 48 1417 0.0E+00
sp|Q1DLC7|NTE1_COCIM Lysophospholipase NTE1 OS=Coccidioides immitis (strain RS) GN=NTE1 PE=3 SV=3 53 1417 0.0E+00
sp|Q2UDH2|NTE1_ASPOR Lysophospholipase nte1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nte1 PE=3 SV=2 47 1417 0.0E+00
sp|A1C9L6|NTE1_ASPCL Lysophospholipase nte1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nte1 PE=3 SV=2 47 1417 0.0E+00
sp|Q0UJ42|NTE1_PHANO Lysophospholipase NTE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NTE1 PE=3 SV=1 476 1417 0.0E+00
sp|Q6CF18|NTE1_YARLI Lysophospholipase NTE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NTE1 PE=3 SV=1 15 1417 0.0E+00
sp|Q9USJ4|NTE1_SCHPO Lysophospholipase NTE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nte1 PE=3 SV=1 60 1394 0.0E+00
sp|Q5A368|NTE1_CANAL Lysophospholipase NTE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NTE1 PE=3 SV=1 31 1395 0.0E+00
sp|A5E708|NTE1_LODEL Lysophospholipase NTE1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NTE1 PE=3 SV=1 66 1395 0.0E+00
sp|Q6FKJ1|NTE1_CANGA Lysophospholipase NTE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NTE1 PE=3 SV=1 591 1395 0.0E+00
sp|Q756Z0|NTE1_ASHGO Lysophospholipase NTE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NTE1 PE=3 SV=1 592 1395 0.0E+00
sp|Q4PF83|NTE1_USTMA Lysophospholipase NTE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NTE1 PE=3 SV=1 675 1399 0.0E+00
sp|P0CP36|NTE1_CRYNJ Lysophospholipase NTE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NTE1 PE=3 SV=1 592 1417 0.0E+00
sp|P0CP37|NTE1_CRYNB Lysophospholipase NTE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NTE1 PE=3 SV=1 592 1417 0.0E+00
sp|Q04958|NTE1_YEAST Lysophospholipase NTE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTE1 PE=1 SV=1 597 1417 0.0E+00
sp|Q6CWC2|NTE1_KLULA Lysophospholipase NTE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NTE1 PE=3 SV=1 515 1417 0.0E+00
sp|A3LYZ4|NTE1_PICST Lysophospholipase NTE1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NTE1 PE=3 SV=2 597 1417 0.0E+00
sp|Q6BQK9|NTE1_DEBHA Lysophospholipase NTE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NTE1 PE=3 SV=2 589 1417 0.0E+00
sp|A5DHA3|NTE1_PICGU Lysophospholipase NTE1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NTE1 PE=3 SV=2 588 1403 0.0E+00
sp|A2AJ88|PLPL7_MOUSE Patatin-like phospholipase domain-containing protein 7 OS=Mus musculus GN=Pnpla7 PE=1 SV=1 340 1394 1.0E-167
sp|Q5BK26|PLPL7_RAT Patatin-like phospholipase domain-containing protein 7 OS=Rattus norvegicus GN=Pnpla7 PE=1 SV=2 340 1381 9.0E-167
sp|Q6ZV29|PLPL7_HUMAN Patatin-like phospholipase domain-containing protein 7 OS=Homo sapiens GN=PNPLA7 PE=1 SV=3 597 1382 8.0E-160
sp|Q8IY17|PLPL6_HUMAN Neuropathy target esterase OS=Homo sapiens GN=PNPLA6 PE=1 SV=2 682 1382 5.0E-154
sp|Q5RDS0|PLPL6_PONAB Neuropathy target esterase OS=Pongo abelii GN=PNPLA6 PE=2 SV=1 682 1382 8.0E-154
sp|Q3TRM4|PLPL6_MOUSE Neuropathy target esterase OS=Mus musculus GN=Pnpla6 PE=1 SV=2 682 1382 7.0E-153
sp|Q9U969|SWS_DROME Neuropathy target esterase sws OS=Drosophila melanogaster GN=sws PE=1 SV=2 684 1408 1.0E-140
sp|B4M709|SWS_DROVI Neuropathy target esterase sws OS=Drosophila virilis GN=sws PE=3 SV=1 684 1408 2.0E-136
sp|B4JLX2|SWS_DROGR Neuropathy target esterase sws OS=Drosophila grimshawi GN=sws PE=3 SV=1 684 1408 6.0E-136
sp|B4L535|SWS_DROMO Neuropathy target esterase sws OS=Drosophila mojavensis GN=sws PE=3 SV=1 659 1408 6.0E-136
sp|B3MRI9|SWS_DROAN Neuropathy target esterase sws OS=Drosophila ananassae GN=sws PE=3 SV=1 659 1408 8.0E-135
sp|B4N1W9|SWS_DROWI Neuropathy target esterase sws OS=Drosophila willistoni GN=sws PE=3 SV=1 684 1408 1.0E-134
sp|B4Q0P3|SWS_DROYA Neuropathy target esterase sws OS=Drosophila yakuba GN=sws PE=3 SV=1 684 1408 2.0E-133
sp|B3NY03|SWS_DROER Neuropathy target esterase sws OS=Drosophila erecta GN=sws PE=3 SV=1 678 1408 3.0E-133
sp|B5DKS8|SWS_DROPS Neuropathy target esterase sws OS=Drosophila pseudoobscura pseudoobscura GN=sws PE=3 SV=1 670 1408 3.0E-133
sp|B4IL64|SWS_DROSE Neuropathy target esterase sws OS=Drosophila sechellia GN=sws PE=3 SV=1 684 1408 5.0E-133
sp|B4H3U8|SWS_DROPE Neuropathy target esterase sws OS=Drosophila persimilis GN=sws PE=3 SV=1 670 1413 2.0E-124
sp|Q02331|YOL4_CAEEL Uncharacterized NTE family protein ZK370.4 OS=Caenorhabditis elegans GN=ZK370.4 PE=3 SV=3 589 1388 6.0E-120
sp|Q0UJ42|NTE1_PHANO Lysophospholipase NTE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NTE1 PE=3 SV=1 47 461 1.0E-118
sp|Q21534|YVL7_CAEEL Uncharacterized NTE family protein M110.7 OS=Caenorhabditis elegans GN=M110.7 PE=3 SV=3 725 1409 4.0E-97
sp|Q8SVN8|NTE1_ENCCU Lysophospholipase NTE1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=NTE1 PE=3 SV=1 745 1417 2.0E-81
sp|A5DHA3|NTE1_PICGU Lysophospholipase NTE1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NTE1 PE=3 SV=2 56 434 5.0E-51
sp|Q6BQK9|NTE1_DEBHA Lysophospholipase NTE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NTE1 PE=3 SV=2 49 402 1.0E-47
sp|A3LYZ4|NTE1_PICST Lysophospholipase NTE1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NTE1 PE=3 SV=2 15 402 4.0E-45
sp|Q6CWC2|NTE1_KLULA Lysophospholipase NTE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NTE1 PE=3 SV=1 151 418 5.0E-41
sp|Q756Z0|NTE1_ASHGO Lysophospholipase NTE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NTE1 PE=3 SV=1 81 450 7.0E-41
sp|Q4PF83|NTE1_USTMA Lysophospholipase NTE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NTE1 PE=3 SV=1 50 286 1.0E-37
sp|Q04958|NTE1_YEAST Lysophospholipase NTE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTE1 PE=1 SV=1 69 426 2.0E-31
sp|P0A643|Y2594_MYCBO Uncharacterized NTE family protein Mb2594 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2594 PE=3 SV=1 1100 1290 6.0E-23
sp|P9WIY7|Y2565_MYCTU Uncharacterized NTE family protein Rv2565 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2565 PE=1 SV=1 1100 1290 6.0E-23
sp|P9WIY6|Y2565_MYCTO Uncharacterized NTE family protein MT2641 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2641 PE=3 SV=1 1100 1290 8.0E-23
sp|O34731|YLBK_BACSU Uncharacterized NTE family protein YlbK OS=Bacillus subtilis (strain 168) GN=ylbK PE=3 SV=1 1112 1391 1.0E-21
sp|P0AFR1|RSSA_SHIFL NTE family protein RssA OS=Shigella flexneri GN=rssA PE=3 SV=2 1112 1369 1.0E-20
sp|P0AFR0|RSSA_ECOLI NTE family protein RssA OS=Escherichia coli (strain K12) GN=rssA PE=1 SV=2 1112 1369 1.0E-20
sp|P0CP36|NTE1_CRYNJ Lysophospholipase NTE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NTE1 PE=3 SV=1 56 272 4.0E-17
sp|P0CP37|NTE1_CRYNB Lysophospholipase NTE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NTE1 PE=3 SV=1 56 272 4.0E-17
sp|Q4PF83|NTE1_USTMA Lysophospholipase NTE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NTE1 PE=3 SV=1 334 429 5.0E-17
sp|P0CP36|NTE1_CRYNJ Lysophospholipase NTE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NTE1 PE=3 SV=1 340 432 2.0E-16
sp|P0CP37|NTE1_CRYNB Lysophospholipase NTE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NTE1 PE=3 SV=1 340 432 2.0E-16
sp|Q6FKJ1|NTE1_CANGA Lysophospholipase NTE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NTE1 PE=3 SV=1 232 428 5.0E-16
sp|Q6FKJ1|NTE1_CANGA Lysophospholipase NTE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NTE1 PE=3 SV=1 152 211 1.0E-13
sp|P67099|Y1092_MYCBO Uncharacterized NTE family protein Mb1092c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1092c PE=3 SV=1 1104 1290 2.0E-12
sp|P9WIY9|Y1063_MYCTU Uncharacterized NTE family protein Rv1063c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1063c PE=1 SV=1 1104 1290 2.0E-12
sp|P9WIY8|Y1063_MYCTO Uncharacterized NTE family protein MT1093 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1093 PE=3 SV=1 1104 1290 2.0E-12
sp|P05987|KAPR_DICDI cAMP-dependent protein kinase regulatory subunit OS=Dictyostelium discoideum GN=pkaR PE=1 SV=1 589 838 1.0E-09
sp|Q4PF83|NTE1_USTMA Lysophospholipase NTE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NTE1 PE=3 SV=1 506 627 2.0E-08
sp|Q6ZV29|PLPL7_HUMAN Patatin-like phospholipase domain-containing protein 7 OS=Homo sapiens GN=PNPLA7 PE=1 SV=3 340 406 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 53 72 19
2 93 115 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9255
MASDLPNAAQVVDNVSGSLNAAMESSAWPFSAAETTAAHAVEVRHASGWFDLLGWLLLFTINLVSTVLYWAIRIT
TINVPRILYTLFSTSWTVTMNATTLMLIVAGIVSAVSWVVRYRILNMYSRLPPEPQRKEPEIDLFPDTHEEGAKL
GLASYLDEFLSAIKIFGYLERSVFHELTRSMQTRKLIAGETINLEEEKGFCIVVDGVVEIFVKSSRDPRATVGSQ
RPGWEHSDDEDVVPGQQRYQLLTEVRNGAPMSSLFSIMSLFTEDIKLGLAGEESPRIPHTASSDYRGRGSFRASS
SRAASQVPVSMPNTPHFDVGSDHPTVKTERATQPQTNHHVIARATVDTTIAIIPASAFRRLIRIYPKATSHIVHV
ILSRFQRVTLSHAFNYLGLTSEVLQTEKSMIKYTVCQLPNMLRGDALTRLKEKFSREREKIGKDEETKGIALHNA
AATRRRRSSSSTLRKEAVLFSMAKQRTPSSFNPFDSQRHARISIDPRESADEDNLFRASILECMFTSLGLDGGGT
ASREPESTEGSPRLVSFDQRRTKALYASNAFGFMPPFDNSGDGDTESVTSSGIAALTPPSAQGLSHEMRDEVEIV
FFPKGSVLVEQGERNPGLYYVIDGFLDTGSSDYQGSQSIIQMSGSGDFRAGHEAFGSEETGPDGATDGEKKAPTR
RSVALIKPGGLAGYIGSVSSYRSFIDVVAKTDVYVGFLPRASLERIVDRYPIVLLTMAKRLTNILPRLILHIDFA
LEWVQVNAGQVIYHNGDESDAIYIVLNGRLRLVEDRKDGGMSALAEYGQGESVGELEVLTETARAGTLHAIRDTE
LVKFPRTLFNSLAEEHPNITIKISKIIASRMRAAVDGASQNSGKQAGMGTVNNQRKSTMNLRTVAILPVTAGVPV
VEFGNRLMNALAQVGPPNGATSLNQAAILNHLGKHAFNKMGKLRLSQYLADLEEKYGLVVYVADTNVNSPWTQTC
ITQADSILLVGLAEGSPATGEYERFMLGMKSTARKMLVLLHTERFSRPGLTRSWLRNRMWINGGHYHIQMAFRTN
AIPVHPPSKKLGQALKERVQVLQAEIQKYTSRKVHHTAYYSPDSPFKGDFHRLARRLCGKSIGLVLGGGGARGIS
QIGIIRAMEEAGIPIDLVGGTSIGAFVGALYARHADVVPMFGFAKKFAGRMASLWRFALDLTYPSASYTTGHEFN
RGIFKTFGNMQIEDFWLEFYCNTTNISKSRAEFHTSGYAWRYIRASMSLAGLLPPLCDEGSMLLDGGYVDNLTVS
HMKGLGVNTIFAIDVGALDDDTPQSYGDSLSGMWAFFNRWNPLSSHPNPPTLAEIQGRLAYVSSVDALERAKTMA
GCIYMRPPVDEYGTLDFHKFDELYRMGHKFGKDFLQKLREQGALPVTEETGAKEAMRRTTAPRRASI*
Coding >Hirsu2|9255
ATGGCATCTGACCTGCCAAATGCTGCACAAGTCGTCGACAACGTCTCCGGCAGCCTCAACGCGGCGATGGAGTCG
TCGGCCTGGCCCTTCTCCGCTGCCGAGACCACTGCCGCCCACGCGGTAGAGGTCCGCCATGCGTCTGGCTGGTTC
GACTTGCTCGGCTGGCTGCTGTTATTCACCATCAACCTCGTGTCGACTGTCCTGTATTGGGCCATTCGCATCACC
ACCATCAACGTGCCGCGAATTCTCTATACGCTCTTCTCCACCAGCTGGACGGTGACCATGAACGCCACCACGCTC
ATGCTTATCGTGGCGGGCATCGTGTCAGCCGTCAGCTGGGTCGTGAGGTATCGCATCCTCAACATGTATTCGAGA
CTTCCCCCCGAGCCCCAGCGCAAGGAGCCCGAGATCGACCTTTTCCCCGACACACACGAGGAAGGCGCAAAATTG
GGCCTCGCCAGCTACCTGGATGAGTTCCTGAGCGCCATCAAGATTTTCGGCTACCTGGAGCGCTCCGTCTTCCAC
GAGCTCACTCGGAGCATGCAGACGAGGAAGCTGATTGCCGGGGAGACCATCAACCTGGAGGAAGAGAAGGGCTTC
TGTATCGTGGTCGATGGCGTGGTCGAAATATTCGTCAAGTCCAGCCGAGATCCCCGCGCGACCGTCGGCTCCCAG
CGGCCCGGCTGGGAACATTCGGACGACGAGGATGTGGTCCCTGGCCAGCAGAGGTATCAGCTTCTCACCGAGGTG
CGCAACGGCGCTCCCATGTCGTCCCTCTTTTCAATCATGTCGCTCTTCACCGAAGACATCAAGCTCGGTCTCGCC
GGCGAAGAGTCGCCCCGAATACCGCACACTGCGTCGAGCGACTACAGAGGTCGCGGCTCGTTCAGGGCATCCAGC
TCGAGAGCAGCATCTCAAGTCCCGGTTTCCATGCCGAACACGCCCCATTTCGACGTCGGCTCGGACCATCCTACC
GTCAAGACGGAACGTGCCACGCAACCGCAGACCAATCACCACGTCATCGCCCGTGCTACTGTGGACACGACGATT
GCCATCATACCGGCAAGTGCATTCCGTCGTTTGATCCGGATCTATCCCAAGGCCACATCGCACATTGTACATGTC
ATTCTCTCCCGCTTTCAGAGAGTGACCCTGTCGCACGCGTTCAACTACCTGGGCCTCACCAGCGAGGTCTTACAA
ACGGAGAAGAGCATGATCAAGTACACCGTCTGCCAGCTGCCCAACATGCTGAGGGGCGATGCCTTGACAAGATTG
AAGGAAAAGTTCAGTCGTGAGCGCGAAAAGATCGGGAAAGACGAGGAGACTAAGGGTATCGCCCTGCACAACGCA
GCGGCCACTCGTCGGCGCCGGTCCAGCAGCTCAACCTTGCGTAAGGAGGCAGTGCTCTTCTCCATGGCCAAGCAG
CGGACCCCATCGTCATTCAATCCTTTCGATTCTCAAAGGCACGCGCGCATCTCCATCGACCCGCGCGAGTCCGCC
GATGAAGACAATCTCTTCAGAGCTTCGATTTTGGAGTGTATGTTCACGTCATTGGGACTGGACGGTGGTGGTACG
GCGTCCCGGGAGCCGGAGTCCACCGAGGGATCGCCCAGGTTGGTCTCCTTTGATCAACGACGCACCAAAGCGCTC
TACGCGAGCAATGCCTTTGGCTTCATGCCCCCCTTCGATAACTCCGGGGACGGGGACACCGAGTCTGTGACTTCA
AGCGGCATCGCAGCTCTCACGCCCCCAAGCGCCCAGGGTCTATCGCACGAGATGAGGGACGAAGTCGAAATAGTC
TTCTTCCCCAAAGGCTCCGTCCTCGTCGAGCAAGGGGAGAGAAACCCGGGCTTGTACTACGTCATCGATGGCTTT
CTTGACACTGGGTCGAGCGACTACCAAGGCTCGCAAAGCATCATTCAAATGTCTGGGTCGGGCGACTTCAGAGCA
GGTCATGAAGCATTCGGGTCGGAGGAGACGGGACCGGATGGAGCTACTGATGGCGAGAAAAAAGCGCCTACTCGC
AGAAGTGTGGCCCTGATCAAACCCGGGGGCTTGGCCGGGTACATCGGGAGTGTGTCCTCTTACCGATCCTTCATT
GACGTGGTGGCCAAAACGGACGTTTACGTCGGGTTTTTGCCTCGAGCCTCTCTTGAGAGGATCGTCGATAGGTAT
CCTATCGTCCTACTCACCATGGCGAAGCGGCTGACCAACATCCTGCCGCGTCTCATCCTGCATATCGACTTCGCC
CTGGAATGGGTGCAAGTCAACGCGGGCCAAGTCATCTACCATAACGGCGATGAGAGCGACGCCATATACATCGTA
CTCAACGGCCGTCTGCGGCTTGTGGAAGACAGGAAAGACGGTGGAATGTCGGCTCTCGCCGAGTACGGCCAGGGT
GAAAGCGTTGGCGAGCTCGAGGTACTTACGGAGACTGCGCGAGCCGGGACGCTGCATGCCATCCGCGACACCGAA
CTGGTCAAGTTTCCGCGGACTCTCTTCAACAGCCTTGCTGAGGAGCATCCCAACATCACCATCAAGATCTCTAAG
ATCATAGCCTCTCGTATGAGAGCCGCAGTCGATGGTGCGTCACAGAACAGCGGGAAACAAGCCGGGATGGGGACG
GTCAACAACCAGAGGAAATCGACAATGAACCTACGCACCGTGGCCATCCTACCAGTGACGGCTGGCGTCCCCGTT
GTGGAATTTGGCAATCGTCTGATGAACGCGCTGGCCCAGGTCGGACCGCCCAACGGCGCCACCTCGCTAAACCAA
GCAGCCATTTTGAACCACCTGGGCAAGCATGCCTTCAACAAGATGGGCAAGCTACGGCTTTCTCAGTATCTTGCC
GACTTGGAAGAGAAGTACGGCTTGGTAGTTTATGTGGCCGATACAAACGTCAACTCGCCGTGGACGCAGACATGC
ATCACGCAAGCCGATAGTATCCTGCTCGTGGGCCTGGCTGAGGGGTCTCCGGCCACGGGAGAGTACGAGCGGTTC
ATGCTTGGGATGAAGTCTACCGCACGCAAGATGCTAGTACTTTTGCATACCGAGAGATTCTCTCGGCCCGGACTG
ACCAGATCCTGGCTGCGGAACCGCATGTGGATCAACGGTGGCCACTACCATATCCAGATGGCCTTCAGGACCAAC
GCCATACCAGTGCACCCTCCGTCGAAGAAGTTGGGTCAGGCCCTGAAGGAACGAGTGCAGGTGCTGCAGGCCGAG
ATCCAAAAGTACACGTCGAGGAAGGTGCACCACACCGCATACTACTCCCCAGACAGCCCTTTCAAGGGCGACTTC
CACCGGCTTGCGCGCAGGCTGTGCGGGAAGTCGATTGGCCTTGTTTTGGGAGGAGGCGGAGCGCGAGGAATCAGC
CAGATCGGCATCATCCGAGCCATGGAAGAGGCAGGTATCCCGATCGACCTGGTGGGAGGCACTTCCATTGGGGCC
TTCGTCGGTGCGCTGTACGCGCGACACGCCGATGTCGTGCCCATGTTCGGCTTCGCCAAGAAGTTCGCGGGCCGC
ATGGCCAGCCTGTGGCGGTTTGCCCTGGACCTTACCTATCCGTCGGCTTCCTACACCACCGGACACGAGTTCAAC
CGGGGCATCTTCAAGACGTTTGGCAACATGCAGATTGAAGACTTCTGGCTTGAGTTTTATTGCAACACGACCAAC
ATCAGCAAGAGCAGGGCCGAGTTTCACACGAGCGGATACGCCTGGCGGTACATCCGAGCGTCGATGTCTCTGGCC
GGCCTCCTGCCGCCGCTGTGCGACGAGGGCAGCATGCTCCTGGACGGTGGCTACGTGGATAACCTGACGGTCTCG
CACATGAAGGGCCTGGGGGTCAACACGATCTTCGCCATCGACGTGGGCGCGCTGGACGATGACACGCCGCAGTCG
TATGGAGATTCGTTGTCGGGGATGTGGGCGTTCTTCAACCGGTGGAACCCGCTGTCGTCGCATCCAAACCCGCCG
ACGCTGGCCGAGATCCAAGGCCGACTGGCGTACGTCTCGAGTGTGGACGCGCTTGAGCGAGCCAAGACGATGGCG
GGCTGCATCTACATGCGACCGCCGGTGGACGAGTACGGGACGCTGGACTTTCACAAGTTCGACGAGCTGTACCGG
ATGGGGCACAAGTTTGGCAAGGACTTTCTGCAGAAGCTGCGGGAGCAAGGCGCGCTGCCGGTGACGGAGGAGACG
GGCGCCAAGGAAGCGATGAGGCGGACGACGGCGCCGCGGCGAGCCAGCATCTAG
Transcript >Hirsu2|9255
ATGGCATCTGACCTGCCAAATGCTGCACAAGTCGTCGACAACGTCTCCGGCAGCCTCAACGCGGCGATGGAGTCG
TCGGCCTGGCCCTTCTCCGCTGCCGAGACCACTGCCGCCCACGCGGTAGAGGTCCGCCATGCGTCTGGCTGGTTC
GACTTGCTCGGCTGGCTGCTGTTATTCACCATCAACCTCGTGTCGACTGTCCTGTATTGGGCCATTCGCATCACC
ACCATCAACGTGCCGCGAATTCTCTATACGCTCTTCTCCACCAGCTGGACGGTGACCATGAACGCCACCACGCTC
ATGCTTATCGTGGCGGGCATCGTGTCAGCCGTCAGCTGGGTCGTGAGGTATCGCATCCTCAACATGTATTCGAGA
CTTCCCCCCGAGCCCCAGCGCAAGGAGCCCGAGATCGACCTTTTCCCCGACACACACGAGGAAGGCGCAAAATTG
GGCCTCGCCAGCTACCTGGATGAGTTCCTGAGCGCCATCAAGATTTTCGGCTACCTGGAGCGCTCCGTCTTCCAC
GAGCTCACTCGGAGCATGCAGACGAGGAAGCTGATTGCCGGGGAGACCATCAACCTGGAGGAAGAGAAGGGCTTC
TGTATCGTGGTCGATGGCGTGGTCGAAATATTCGTCAAGTCCAGCCGAGATCCCCGCGCGACCGTCGGCTCCCAG
CGGCCCGGCTGGGAACATTCGGACGACGAGGATGTGGTCCCTGGCCAGCAGAGGTATCAGCTTCTCACCGAGGTG
CGCAACGGCGCTCCCATGTCGTCCCTCTTTTCAATCATGTCGCTCTTCACCGAAGACATCAAGCTCGGTCTCGCC
GGCGAAGAGTCGCCCCGAATACCGCACACTGCGTCGAGCGACTACAGAGGTCGCGGCTCGTTCAGGGCATCCAGC
TCGAGAGCAGCATCTCAAGTCCCGGTTTCCATGCCGAACACGCCCCATTTCGACGTCGGCTCGGACCATCCTACC
GTCAAGACGGAACGTGCCACGCAACCGCAGACCAATCACCACGTCATCGCCCGTGCTACTGTGGACACGACGATT
GCCATCATACCGGCAAGTGCATTCCGTCGTTTGATCCGGATCTATCCCAAGGCCACATCGCACATTGTACATGTC
ATTCTCTCCCGCTTTCAGAGAGTGACCCTGTCGCACGCGTTCAACTACCTGGGCCTCACCAGCGAGGTCTTACAA
ACGGAGAAGAGCATGATCAAGTACACCGTCTGCCAGCTGCCCAACATGCTGAGGGGCGATGCCTTGACAAGATTG
AAGGAAAAGTTCAGTCGTGAGCGCGAAAAGATCGGGAAAGACGAGGAGACTAAGGGTATCGCCCTGCACAACGCA
GCGGCCACTCGTCGGCGCCGGTCCAGCAGCTCAACCTTGCGTAAGGAGGCAGTGCTCTTCTCCATGGCCAAGCAG
CGGACCCCATCGTCATTCAATCCTTTCGATTCTCAAAGGCACGCGCGCATCTCCATCGACCCGCGCGAGTCCGCC
GATGAAGACAATCTCTTCAGAGCTTCGATTTTGGAGTGTATGTTCACGTCATTGGGACTGGACGGTGGTGGTACG
GCGTCCCGGGAGCCGGAGTCCACCGAGGGATCGCCCAGGTTGGTCTCCTTTGATCAACGACGCACCAAAGCGCTC
TACGCGAGCAATGCCTTTGGCTTCATGCCCCCCTTCGATAACTCCGGGGACGGGGACACCGAGTCTGTGACTTCA
AGCGGCATCGCAGCTCTCACGCCCCCAAGCGCCCAGGGTCTATCGCACGAGATGAGGGACGAAGTCGAAATAGTC
TTCTTCCCCAAAGGCTCCGTCCTCGTCGAGCAAGGGGAGAGAAACCCGGGCTTGTACTACGTCATCGATGGCTTT
CTTGACACTGGGTCGAGCGACTACCAAGGCTCGCAAAGCATCATTCAAATGTCTGGGTCGGGCGACTTCAGAGCA
GGTCATGAAGCATTCGGGTCGGAGGAGACGGGACCGGATGGAGCTACTGATGGCGAGAAAAAAGCGCCTACTCGC
AGAAGTGTGGCCCTGATCAAACCCGGGGGCTTGGCCGGGTACATCGGGAGTGTGTCCTCTTACCGATCCTTCATT
GACGTGGTGGCCAAAACGGACGTTTACGTCGGGTTTTTGCCTCGAGCCTCTCTTGAGAGGATCGTCGATAGGTAT
CCTATCGTCCTACTCACCATGGCGAAGCGGCTGACCAACATCCTGCCGCGTCTCATCCTGCATATCGACTTCGCC
CTGGAATGGGTGCAAGTCAACGCGGGCCAAGTCATCTACCATAACGGCGATGAGAGCGACGCCATATACATCGTA
CTCAACGGCCGTCTGCGGCTTGTGGAAGACAGGAAAGACGGTGGAATGTCGGCTCTCGCCGAGTACGGCCAGGGT
GAAAGCGTTGGCGAGCTCGAGGTACTTACGGAGACTGCGCGAGCCGGGACGCTGCATGCCATCCGCGACACCGAA
CTGGTCAAGTTTCCGCGGACTCTCTTCAACAGCCTTGCTGAGGAGCATCCCAACATCACCATCAAGATCTCTAAG
ATCATAGCCTCTCGTATGAGAGCCGCAGTCGATGGTGCGTCACAGAACAGCGGGAAACAAGCCGGGATGGGGACG
GTCAACAACCAGAGGAAATCGACAATGAACCTACGCACCGTGGCCATCCTACCAGTGACGGCTGGCGTCCCCGTT
GTGGAATTTGGCAATCGTCTGATGAACGCGCTGGCCCAGGTCGGACCGCCCAACGGCGCCACCTCGCTAAACCAA
GCAGCCATTTTGAACCACCTGGGCAAGCATGCCTTCAACAAGATGGGCAAGCTACGGCTTTCTCAGTATCTTGCC
GACTTGGAAGAGAAGTACGGCTTGGTAGTTTATGTGGCCGATACAAACGTCAACTCGCCGTGGACGCAGACATGC
ATCACGCAAGCCGATAGTATCCTGCTCGTGGGCCTGGCTGAGGGGTCTCCGGCCACGGGAGAGTACGAGCGGTTC
ATGCTTGGGATGAAGTCTACCGCACGCAAGATGCTAGTACTTTTGCATACCGAGAGATTCTCTCGGCCCGGACTG
ACCAGATCCTGGCTGCGGAACCGCATGTGGATCAACGGTGGCCACTACCATATCCAGATGGCCTTCAGGACCAAC
GCCATACCAGTGCACCCTCCGTCGAAGAAGTTGGGTCAGGCCCTGAAGGAACGAGTGCAGGTGCTGCAGGCCGAG
ATCCAAAAGTACACGTCGAGGAAGGTGCACCACACCGCATACTACTCCCCAGACAGCCCTTTCAAGGGCGACTTC
CACCGGCTTGCGCGCAGGCTGTGCGGGAAGTCGATTGGCCTTGTTTTGGGAGGAGGCGGAGCGCGAGGAATCAGC
CAGATCGGCATCATCCGAGCCATGGAAGAGGCAGGTATCCCGATCGACCTGGTGGGAGGCACTTCCATTGGGGCC
TTCGTCGGTGCGCTGTACGCGCGACACGCCGATGTCGTGCCCATGTTCGGCTTCGCCAAGAAGTTCGCGGGCCGC
ATGGCCAGCCTGTGGCGGTTTGCCCTGGACCTTACCTATCCGTCGGCTTCCTACACCACCGGACACGAGTTCAAC
CGGGGCATCTTCAAGACGTTTGGCAACATGCAGATTGAAGACTTCTGGCTTGAGTTTTATTGCAACACGACCAAC
ATCAGCAAGAGCAGGGCCGAGTTTCACACGAGCGGATACGCCTGGCGGTACATCCGAGCGTCGATGTCTCTGGCC
GGCCTCCTGCCGCCGCTGTGCGACGAGGGCAGCATGCTCCTGGACGGTGGCTACGTGGATAACCTGACGGTCTCG
CACATGAAGGGCCTGGGGGTCAACACGATCTTCGCCATCGACGTGGGCGCGCTGGACGATGACACGCCGCAGTCG
TATGGAGATTCGTTGTCGGGGATGTGGGCGTTCTTCAACCGGTGGAACCCGCTGTCGTCGCATCCAAACCCGCCG
ACGCTGGCCGAGATCCAAGGCCGACTGGCGTACGTCTCGAGTGTGGACGCGCTTGAGCGAGCCAAGACGATGGCG
GGCTGCATCTACATGCGACCGCCGGTGGACGAGTACGGGACGCTGGACTTTCACAAGTTCGACGAGCTGTACCGG
ATGGGGCACAAGTTTGGCAAGGACTTTCTGCAGAAGCTGCGGGAGCAAGGCGCGCTGCCGGTGACGGAGGAGACG
GGCGCCAAGGAAGCGATGAGGCGGACGACGGCGCCGCGGCGAGCCAGCATCTAG
Gene >Hirsu2|9255
ATGGCATCTGACCTGCCAAATGCTGCACAAGTCGTCGACAACGTCTCCGGCAGCCTCAACGCGGCGATGGAGTCG
TCGGCCTGGCCCTTCTCCGCTGCCGAGACCACTGCCGCCCACGCGGTAGAGGTCCGCCATGCGTCTGGCTGGTTC
GACTTGCTCGGCTGGCTGCTGTTATTCACCATCAACCTCGTGTCGACTGTCCTGTATTGGGCCATTCGCATCACC
ACCATCAACGTGCCGCGAATTCTCTATACGCTCTTCTCCACCAGCTGGACGGTGACCATGAACGCCACCACGCTG
TATGTTTGTCCCTTCGACACGCGGCGCTCAAGACTCACATCTCGTCTAGCATGCTTATCGTGGCGGGCATCGTGT
CAGCCGTCAGCTGGGTCGTGAGGTATCGCATCCTCAACATGTATTCGAGACTTCCCCCCGAGCCCCAGCGCAAGG
AGCCCGAGATCGACCTTTTCCCCGACACACACGAGGAAGGCGCAAAATTGGGCCTCGCCAGCTACCTGGATGAGT
TCCTGAGCGCCATCAAGATTTTCGGCTACCTGGAGCGCTCCGTCTTCCACGAGCTCACTCGGAGCATGCAGACGA
GGAAGCTGATTGCCGGGGAGACCATCAACCTGGAGGAAGAGAAGGGCTTCTGTATCGTGGTCGATGGCGTGGTCG
AAATATTCGTCAAGTCCAGCCGAGATCCCCGCGCGACCGTCGGCTCCCAGCGGCCCGGCTGGGAACATTCGGACG
ACGAGGATGTGGTCCCTGGCCAGCAGAGGTATCAGCTTCTCACCGAGGTGCGCAACGGCGCTCCCATGTCGTCCC
TCTTTTCAATCATGTCGCTCTTCACCGAAGACATCAAGCTCGGTCTCGCCGGCGAAGAGTCGCCCCGAATACCGC
ACACTGCGTCGAGCGACTACAGAGGTCGCGGCTCGTTCAGGGCATCCAGCTCGAGAGCAGCATCTCAAGTCCCGG
TTTCCATGCCGAACACGCCCCATTTCGACGTCGGCTCGGACCATCCTACCGTCAAGACGGAACGTGCCACGCAAC
CGCAGACCAATCACCGTCCTACAACCTCGAGTATTCCCCCAATGTCGCTTGACACCTCTGGCCTTTCGTCCGCCA
ATTCGGCACAGAAACCTGGCCTGTCCCGTCGAATGACTTCGAGCTCCGCACACCCAGACGTCATCGCCCGTGCTA
CTGTGGACACGACGATTGCCATCATACCGGCAAGTGCATTCCGTCGTTTGATCCGGATCTATCCCAAGGCCACAT
CGCACATTGTACATGTCATTCTCTCCCGCTTTCAGAGAGTGACCCTGTCGCACGCGTTCAACTACCTGGGCCTCA
CCAGCGAGGTCTTACAAACGGAGAAGAGCATGATCAAGTACACCGTCTGCCAGCTGCCCAACATGCTGAGGGGCG
ATGCCTTGACAAGATTGAAGGAAAAGTTCAGTCGTGAGCGCGAAAAGATCGGGAAAGACGAGGAGACTAAGGGTA
TCGCCCTGCACAACGCAGCGGCCACTCGTCGGCGCCGGTCCAGCAGCTCAACCTTGCGTAAGGAGGCAGTGCTCT
TCTCCATGGCCAAGCAGCGGACCCCATCGTCGGGTGGTGGCTCGGCCGTCCCCGCGCATGCACTGCATGATTATC
GGACCAATCCTGGCGATCTGCTCGCACAAACCCATCTGGCTCGTTCTGCAGGCAGGACAGCTGCGGCCGGTGCAA
TAATGGGGTCGATATCGAATCCATCAACCGAATTACTGACGCCTCTGGATTCAAGGTCATTCAATCCTTTCGATT
CTCAAAGGCACGCGCGCATCTCCATCGACCCGCGCGAGTCCGCCGATGAAGACAATCTCTTCAGAGCTTCGATTT
TGGAGTGTATGTTCACGTCATTGGGACTGGACGGTGGTGGTACGGCGTCCCGGGAGCCGGAGTCCACCGAGGGAT
CGCCCAGGTTGGTCTCCTTTGATCAACGACGCACCAAAGCGCTCTACGCGAGCAATGCCTTTGGCTTCATGCCCC
CCTTCGATAACTCCGGGGACGGGGACACCGAGTCTGTGACTTCAAGCGGCATCGCAGCTCTCACGCCCCCAAGCG
CCCAGGGTCTATCGCACGAGATGAGGGACGAAGTCGAAATAGTCTTCTTCCCCAAAGGCTCCGTCCTCGTCGAGC
AAGGGGAGAGAAACCCGGGCTTGTACTACGTCATCGATGGCTTTCTTGACACTGGGTCGAGCGACTACCAAGGCT
CGCAAAGCATCATTCAAATGTCTGGGTCGGGCGACTTCAGAGCAGGTCATGAAGCATTCGGGTCGGAGGAGACGG
GACCGGATGGAGCTACTGATGGCGAGAAAAAAGCGCCTACTCGCAGAAGTGTGGCCCTGATCAAACCCGGGGGCT
TGGCCGGGTACATCGGGAGTGTGTCCTCTTACCGATCCTTCATTGACGTGGTGGCCAAAACGGACGTTTACGTCG
GGTTTTTGCCTCGAGCCTCTCTTGAGAGGATCGTCGATAGGTATCCTATCGTCCTACTCACCATGGCGAAGCGGC
TGACCAACATCCTGCCGCGTCTCATCCTGCATATCGACTTCGCCCTGGAATGGGTGCAAGTCAACGCGGGCCAAG
TCATCTACCATAACGGCGATGAGAGCGACGCCATATACATCGTACTCAACGGCCGTCTGCGGCTTGTGGAAGACA
GGAAAGACGGTGGAATGTCGGCTCTCGCCGAGTACGGCCAGGGTGAAAGCGTTGGCGAGCTCGAGGTACTTACGG
AGACTGCGCGAGCCGGGACGCTGCATGCCATCCGCGACACCGAACTGGTCAAGTTTCCGCGGACTCTCTTCAACA
GCCTTGCTGAGGAGCATCCCAACATCACCATCAAGATCTCTAAGATCATAGCCTCTCGTATGAGAGCCGCAGTCG
ATGGTGCGTCACAGAACAGCGGGAAACAAGCCGGGATGGGGACGGTCAACAACCAGAGGAAATCGACAATGAACC
TACGCACCGTGGCCATCCTACCAGTGACGGCTGGCGTCCCCGTTGTGGAATTTGGCAATCGTCTGATGAACGCGC
TGGCCCAGGTCGGACCGCCCAACGGCGCCACCTCGCTAAACCAAGCAGCCATTTTGAACCACCTGGGCAAGCATG
CCTTCAACAAGATGGGCAAGCTACGGCTTTCTCAGTATCTTGCCGACTTGGAAGAGAAGTACGGCTTGGTAGTTT
ATGTGGCCGGTGAGAAACCCCTCGTCATTTTTTTTCTTTTGCATCGCGTTACTTGCCCTGCTTTTCTTGCATCAT
GATGAGAACTTTCAAACCACAGGCGAACAGCCCATGATGGTCTTTCTTAACTCTAATTTTTTCCTGATTGCGCCG
TTCTGCTCCCGAAGATGATGAAACTCGCAGGCGACTGGTCGAGTGCTAATATCGACCCTCCAGATACAAACGTCA
ACTCGCCGTGGACGCAGACATGCATCACGCAAGCCGATAGTATCCTGCTCGTGGGCCTGGCTGAGGGGTCTCCGG
CCACGGGAGAGTACGAGCGGTTCATGCTTGGGATGAAGTCTACCGCACGCAAGATGCTAGTACTTTTGCATACCG
AGAGATTCTCTCGGCCCGGACTGACCAGATCCTGGCTGCGGAACCGCATGTGGATCAACGGTGGCCACTACCATA
TCCAGATGGCCTTCAGGACCAACGCCATACCAGTGCACCCTCCGTCGAAGAAGTTGGGTCAGGCCCTGAAGGAAC
GAGTGCAGGTGCTGCAGGCCGAGATCCAAAAGTACACGTCGAGGAAGGTGCACCACACCGCATACTACTCCCCAG
ACAGCCCTTTCAAGGGCGACTTCCACCGGCTTGCGCGCAGGCTGTGCGGGAAGTCGATTGGCCTTGTTTTGGGAG
GAGGCGGAGCGCGAGGAATCAGCCAGATCGGCATCATCCGAGCCATGGAAGAGGCAGGTATCCCGATCGACCTGG
TGGGAGGCACTTCCATTGGGGCCTTCGTCGGTGCGCTGTACGCGCGACACGCCGATGTCGTGCCCATGTTCGGCT
TCGCCAAGAAGTTCGCGGGCCGCATGGCCAGCCTGTGGCGGTTTGCCCTGGACCTTACCTATCCGTCGGCTTCCT
ACACCACCGGACACGAGTTCAACCGGGGCATCTTCAAGACGTTTGGCAACATGCAGATTGAAGACTTCTGGCTTG
AGTTTTATTGCAACACGACCAACATCAGCAAGAGCAGGGCCGAGTTTCACACGAGCGGATACGCCTGGCGGTACA
TCCGAGCGTCGATGTCTCTGGCCGGCCTCCTGCCGCCGCTGTGCGACGAGGGCAGCATGCTCCTGGACGGTGGCT
ACGTGGATAACCTGACGGTCTCGCACATGAAGGGCCTGGGGGTCAACACGATCTTCGCCATCGACGTGGGCGCGC
TGGACGATGACACGCCGCAGTCGTATGGAGATTCGTTGTCGGGGATGTGGGCGTTCTTCAACCGGTGGAACCCGC
TGTCGTCGCATCCAAACCCGCCGACGCTGGCCGAGATCCAAGGCCGACTGGCGTACGTCTCGAGTGTGGACGCGC
TTGAGCGAGCCAAGACGATGGCGGGCTGCATCTACATGCGACCGCCGGTGGACGAGTACGGGACGCTGGACTTTC
ACAAGTTCGACGAGCTGTACCGGATGGGGCACAAGTTTGGCAAGGACTTTCTGCAGAAGCTGCGGGAGCAAGGCG
CGCTGCCGGTGACGGAGGAGACGGGCGCCAAGGAAGCGATGAGGCGGACGACGGCGCCGCGGCGAGCCAGCATCT
AG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail