Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9254
Gene name
LocationContig_660:6845..8044
Strand-
Gene length (bp)1199
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein 2.1E-76 7 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTL7|GPN2_SCHPO GPN-loop GTPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpn2 PE=3 SV=1 1 315 2.0E-109
sp|Q08726|GPN2_YEAST GPN-loop GTPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPN2 PE=1 SV=1 1 292 4.0E-108
sp|Q6PUR6|GPN2_DANRE GPN-loop GTPase 2 OS=Danio rerio GN=gpn2 PE=2 SV=1 3 297 1.0E-91
sp|Q54TE7|GPN2_DICDI GPN-loop GTPase 2 homolog OS=Dictyostelium discoideum GN=gpn2 PE=2 SV=1 1 313 1.0E-84
sp|Q8VEJ1|GPN2_MOUSE GPN-loop GTPase 2 OS=Mus musculus GN=Gpn2 PE=2 SV=2 3 296 9.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTL7|GPN2_SCHPO GPN-loop GTPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpn2 PE=3 SV=1 1 315 2.0E-109
sp|Q08726|GPN2_YEAST GPN-loop GTPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPN2 PE=1 SV=1 1 292 4.0E-108
sp|Q6PUR6|GPN2_DANRE GPN-loop GTPase 2 OS=Danio rerio GN=gpn2 PE=2 SV=1 3 297 1.0E-91
sp|Q54TE7|GPN2_DICDI GPN-loop GTPase 2 homolog OS=Dictyostelium discoideum GN=gpn2 PE=2 SV=1 1 313 1.0E-84
sp|Q8VEJ1|GPN2_MOUSE GPN-loop GTPase 2 OS=Mus musculus GN=Gpn2 PE=2 SV=2 3 296 9.0E-82
sp|Q4R579|GPN2_MACFA GPN-loop GTPase 2 OS=Macaca fascicularis GN=GPN2 PE=2 SV=1 3 291 1.0E-80
sp|Q58DD9|GPN2_PIG GPN-loop GTPase 2 OS=Sus scrofa GN=GPN2 PE=2 SV=1 3 301 1.0E-80
sp|A6H7F2|GPN2_BOVIN GPN-loop GTPase 2 OS=Bos taurus GN=GPN2 PE=2 SV=1 3 296 2.0E-80
sp|D4A7C0|GPN2_RAT GPN-loop GTPase 2 OS=Rattus norvegicus GN=Gpn2 PE=3 SV=1 3 301 6.0E-80
sp|Q9H9Y4|GPN2_HUMAN GPN-loop GTPase 2 OS=Homo sapiens GN=GPN2 PE=1 SV=2 3 291 2.0E-79
sp|Q66KF6|GPN2_XENLA GPN-loop GTPase 2 OS=Xenopus laevis GN=gpn2 PE=2 SV=1 3 292 2.0E-74
sp|Q5BJ53|GPN2_XENTR GPN-loop GTPase 2 OS=Xenopus tropicalis GN=gpn2 PE=2 SV=1 3 274 9.0E-72
sp|Q6ZM63|GPN3_DANRE GPN-loop GTPase 3 OS=Danio rerio GN=gpn3 PE=2 SV=2 1 257 4.0E-59
sp|Q9D3W4|GPN3_MOUSE GPN-loop GTPase 3 OS=Mus musculus GN=Gpn3 PE=2 SV=1 1 257 4.0E-58
sp|Q6R518|GPN3_RAT GPN-loop GTPase 3 OS=Rattus norvegicus GN=Gpn3 PE=2 SV=1 1 257 5.0E-58
sp|Q9UHW5|GPN3_HUMAN GPN-loop GTPase 3 OS=Homo sapiens GN=GPN3 PE=1 SV=2 1 257 2.0E-57
sp|Q0P5E2|GPN3_BOVIN GPN-loop GTPase 3 OS=Bos taurus GN=GPN3 PE=2 SV=1 1 257 4.0E-57
sp|Q28I42|GPN3_XENTR GPN-loop GTPase 3 OS=Xenopus tropicalis GN=gpn3 PE=2 SV=1 1 257 2.0E-55
sp|Q54NK8|GPN3_DICDI GPN-loop GTPase 3 OS=Dictyostelium discoideum GN=gpn3 PE=3 SV=1 4 257 6.0E-55
sp|Q6CQA6|GPN3_KLULA GPN-loop GTPase 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0D18557g PE=3 SV=2 6 252 1.0E-54
sp|Q4V7Z0|GPN3_XENLA GPN-loop GTPase 3 OS=Xenopus laevis GN=gpn3 PE=2 SV=1 1 257 3.0E-54
sp|Q750Q9|GPN3_ASHGO GPN-loop GTPase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGL117C PE=3 SV=1 6 252 2.0E-53
sp|Q06543|GPN3_YEAST GPN-loop GTPase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPN3 PE=1 SV=1 6 269 1.0E-52
sp|Q5A0W6|GPN3_CANAL GPN-loop GTPase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.10642 PE=3 SV=2 6 252 3.0E-52
sp|Q6FSS0|GPN3_CANGA GPN-loop GTPase 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G08294g PE=3 SV=1 6 252 5.0E-52
sp|Q6BI59|GPN3_DEBHA GPN-loop GTPase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G13222g PE=3 SV=2 6 252 2.0E-51
sp|Q6CBB5|GPN3_YARLI GPN-loop GTPase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0C20317g PE=3 SV=1 6 252 4.0E-49
sp|O14443|GPN3_SCHPO GPN-loop GTPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fet5 PE=2 SV=1 4 257 2.0E-47
sp|Q4WT40|GPN3_ASPFU GPN-loop GTPase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G10640 PE=3 SV=1 3 254 8.0E-45
sp|P0CN94|GPN3_CRYNJ GPN-loop GTPase 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB04680 PE=3 SV=1 1 257 2.0E-41
sp|P0CN95|GPN3_CRYNB GPN-loop GTPase 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB1090 PE=3 SV=1 1 257 2.0E-41
sp|Q4IQT8|GPN3_GIBZE GPN-loop GTPase 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_00420 PE=3 SV=1 3 252 7.0E-41
sp|Q4PF70|GPN3_USTMA GPN-loop GTPase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_01243 PE=3 SV=1 3 257 7.0E-41
sp|Q9HCN4|GPN1_HUMAN GPN-loop GTPase 1 OS=Homo sapiens GN=GPN1 PE=1 SV=1 2 176 3.0E-25
sp|A4FUD1|GPN1_BOVIN GPN-loop GTPase 1 OS=Bos taurus GN=GPN1 PE=2 SV=1 2 176 9.0E-25
sp|Q8VCE2|GPN1_MOUSE GPN-loop GTPase 1 OS=Mus musculus GN=Gpn1 PE=1 SV=1 2 176 9.0E-24
sp|P46577|GPN1_CAEEL GPN-loop GTPase 1 OS=Caenorhabditis elegans GN=gop-2 PE=1 SV=1 6 176 6.0E-23
sp|Q54C25|GPN1_DICDI GPN-loop GTPase 1 OS=Dictyostelium discoideum GN=gpn1 PE=3 SV=1 2 174 8.0E-22
sp|O42906|GPN1_SCHPO GPN-loop GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC119.15 PE=1 SV=1 2 324 9.0E-18
sp|P47122|GPN1_YEAST GPN-loop GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPA3 PE=1 SV=1 6 195 3.0E-14
sp|Q9UYR9|GPN_PYRAB GPN-loop GTPase PAB0955 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14380 PE=1 SV=2 6 196 2.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9254
MPFAQLVLGSPGSGKSTYCDGMHQFMGAVGRACSVVNLDPANDQTSYPCALDIRSLVKLEDIMREDKLGPNGGIL
YALEELEHNFEWLQEGLAGFGDDYVLFDCPGQVELYTHHNSLRNIFHKLQKSGFRFVCIHLSDSICVTQPSLYIS
NVLLSLRAMIQMDMPHVNVLSKIDKVSSYDELPFNLEYYTDVDDLTYLTPFLDAESPALRSEKFGRLNEAVANMI
ESYGLVRYEVLAVENKKSMMHLLRVIDRAGGYVFGGAEGANDTIWAVAMRNEASMLDVQDIQERWIDQKEEHDRL
ERQADEEQSNMAREQAMESEQSSRPVGERDVDMESDFGDMSIPADSGVRVVRKK*
Coding >Hirsu2|9254
ATGCCTTTCGCGCAGCTGGTTCTGGGCAGTCCGGGCTCCGGAAAGAGCACGTACTGCGATGGCATGCACCAATTC
ATGGGCGCCGTCGGGCGTGCGTGTTCCGTCGTGAACCTCGATCCGGCCAATGACCAGACTAGCTACCCATGCGCG
CTCGACATCCGGAGTCTGGTCAAGTTGGAGGATATCATGCGAGAGGACAAACTAGGGCCGAACGGCGGCATCCTC
TACGCCCTGGAGGAGCTTGAACATAACTTCGAGTGGCTGCAGGAGGGCCTGGCTGGGTTCGGGGACGACTACGTG
CTGTTCGACTGCCCCGGGCAGGTCGAGCTGTACACTCATCACAACTCGCTCAGGAACATCTTCCACAAGCTCCAA
AAATCGGGCTTCAGGTTTGTCTGCATACATCTTTCCGACTCCATCTGCGTCACGCAGCCTTCCCTTTACATTTCC
AACGTTCTCTTATCCCTGCGGGCGATGATCCAGATGGACATGCCCCATGTCAACGTCCTGTCTAAGATAGACAAG
GTCTCATCATACGACGAGTTGCCCTTCAACCTCGAGTACTATACTGACGTCGACGACCTGACGTATCTGACTCCA
TTCCTCGACGCAGAATCTCCTGCCCTGCGCAGCGAGAAGTTTGGCCGGCTCAATGAGGCCGTCGCCAACATGATC
GAAAGCTACGGCTTGGTAAGATATGAAGTACTGGCGGTCGAGAACAAGAAGAGCATGATGCATTTGCTGCGGGTC
ATCGACCGTGCTGGCGGGTATGTTTTCGGGGGCGCCGAAGGTGCCAACGACACCATATGGGCTGTCGCAATGCGG
AACGAGGCATCCATGCTGGATGTTCAGGACATCCAGGAGCGGTGGATCGACCAAAAAGAGGAACACGACCGGCTC
GAACGGCAGGCTGACGAAGAGCAATCGAATATGGCGCGGGAACAGGCAATGGAATCAGAGCAGTCGTCCAGGCCT
GTGGGAGAGCGTGATGTGGACATGGAGTCTGACTTTGGGGATATGTCGATACCGGCAGACAGCGGAGTTAGGGTG
GTGAGGAAAAAATGA
Transcript >Hirsu2|9254
ATGCCTTTCGCGCAGCTGGTTCTGGGCAGTCCGGGCTCCGGAAAGAGCACGTACTGCGATGGCATGCACCAATTC
ATGGGCGCCGTCGGGCGTGCGTGTTCCGTCGTGAACCTCGATCCGGCCAATGACCAGACTAGCTACCCATGCGCG
CTCGACATCCGGAGTCTGGTCAAGTTGGAGGATATCATGCGAGAGGACAAACTAGGGCCGAACGGCGGCATCCTC
TACGCCCTGGAGGAGCTTGAACATAACTTCGAGTGGCTGCAGGAGGGCCTGGCTGGGTTCGGGGACGACTACGTG
CTGTTCGACTGCCCCGGGCAGGTCGAGCTGTACACTCATCACAACTCGCTCAGGAACATCTTCCACAAGCTCCAA
AAATCGGGCTTCAGGTTTGTCTGCATACATCTTTCCGACTCCATCTGCGTCACGCAGCCTTCCCTTTACATTTCC
AACGTTCTCTTATCCCTGCGGGCGATGATCCAGATGGACATGCCCCATGTCAACGTCCTGTCTAAGATAGACAAG
GTCTCATCATACGACGAGTTGCCCTTCAACCTCGAGTACTATACTGACGTCGACGACCTGACGTATCTGACTCCA
TTCCTCGACGCAGAATCTCCTGCCCTGCGCAGCGAGAAGTTTGGCCGGCTCAATGAGGCCGTCGCCAACATGATC
GAAAGCTACGGCTTGGTAAGATATGAAGTACTGGCGGTCGAGAACAAGAAGAGCATGATGCATTTGCTGCGGGTC
ATCGACCGTGCTGGCGGGTATGTTTTCGGGGGCGCCGAAGGTGCCAACGACACCATATGGGCTGTCGCAATGCGG
AACGAGGCATCCATGCTGGATGTTCAGGACATCCAGGAGCGGTGGATCGACCAAAAAGAGGAACACGACCGGCTC
GAACGGCAGGCTGACGAAGAGCAATCGAATATGGCGCGGGAACAGGCAATGGAATCAGAGCAGTCGTCCAGGCCT
GTGGGAGAGCGTGATGTGGACATGGAGTCTGACTTTGGGGATATGTCGATACCGGCAGACAGCGGAGTTAGGGTG
GTGAGGAAAAAATGA
Gene >Hirsu2|9254
ATGCCTTTCGCGCAGCTGGTTCTGGGCAGTCCGGGCTCCGGAAAGAGCACGTACTGCGATGGCAGTAAGTGCTTC
TGCTCCAGGCGACAAGTCGCCGAGCGCATCTGGTTCTGACTCTGACCTTTATCTCCCGTCAGTGCACCAATTCAT
GGGCGCCGTCGGGCGTGCGTGTTCCGTCGTGAACCTCGATCCGGCCAATGACCAGACTAGCTACCCATGCGCGCT
CGACATCCGGAGTCTGGTCAAGTTGGAGGATATCATGCGAGAGGACAAACTAGGGCCGAACGGCGGCATCCTCTA
CGCCCTGGAGGAGCTTGAACATAACTTCGAGTGGCTGCAGGAGGGCCTGGCTGGGTTCGGGGACGACTACGTGCT
GTTCGACTGCCCCGGGCAGGTCGAGCTGTACACTCATCACAACTCGCTCAGGAACATCTTCCACAAGCTCCAAAA
ATCGGGCTTCAGGGTACGTCTCGCCGATGGTGAGGGGGTTGAGATTGACTCTTGCATTCGCTGACCCGCCTTAGT
TTGTCTGCATACATCTTTCCGACTCCATCTGCGTCACGCAGCCTTCCCTTTACATTTCCAACGTTCTCTTATCCC
TGCGGGCGATGATCCAGATGGACATGCCCCATGTCAACGTCCTGTCTAAGATAGACAAGGTCTCATCATACGACG
AGTTGCCCTTCAACCTCGAGTACTATACTGACGTCGACGACCTGACGTATCTGACTCCATTCCTCGACGCAGAAT
CTCCTGCCCTGCGCAGCGAGAAGTTTGGCCGGCTCAATGAGGCCGTCGCCAACATGATCGAAAGCTACGGCTTGG
TAAGATATGAAGTACTGGCGGTCGAGAACAAGAAGAGCATGATGCATTTGCTGCGGGTCATCGACCGTGCTGGCG
GGTATGTTTTCGGGGGCGCCGAAGGTGCCAACGACACCATATGGGCTGTCGCAATGCGGAACGAGGCATCCATGC
TGGATGTTCAGGACATCCAGGAGCGGTGGATCGACCAAAAAGAGGAACACGACCGGCTCGAACGGCAGGCTGACG
AAGAGCAATCGAATATGGCGCGGGAACAGGCAATGGAATCAGAGCAGTCGTCCAGGCCTGTGGGAGAGCGTGATG
TGGACATGGAGTCTGACTTTGGGGATATGTCGATACCGGCAGACAGCGGAGTTAGGGTGGTGAGGAAAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail