Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9251
Gene name
LocationContig_660:1952..2928
Strand+
Gene length (bp)976
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00137 ATP-synt_C ATP synthase subunit C 4.1E-15 47 105
PF00137 ATP-synt_C ATP synthase subunit C 3.1E-10 133 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14046|VATO_SCHPO Probable V-type proton ATPase 20 kDa proteolipid subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma16 PE=3 SV=1 16 197 3.0E-81
sp|P23968|VATO_YEAST V-type proton ATPase subunit c'' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA16 PE=1 SV=1 16 197 5.0E-67
sp|Q91V37|VATO_MOUSE V-type proton ATPase 21 kDa proteolipid subunit OS=Mus musculus GN=Atp6v0b PE=1 SV=1 14 195 2.0E-60
sp|Q2TA24|VATO_BOVIN V-type proton ATPase 21 kDa proteolipid subunit OS=Bos taurus GN=ATP6V0B PE=2 SV=1 14 195 3.0E-60
sp|Q99437|VATO_HUMAN V-type proton ATPase 21 kDa proteolipid subunit OS=Homo sapiens GN=ATP6V0B PE=2 SV=1 27 195 5.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14046|VATO_SCHPO Probable V-type proton ATPase 20 kDa proteolipid subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma16 PE=3 SV=1 16 197 3.0E-81
sp|P23968|VATO_YEAST V-type proton ATPase subunit c'' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA16 PE=1 SV=1 16 197 5.0E-67
sp|Q91V37|VATO_MOUSE V-type proton ATPase 21 kDa proteolipid subunit OS=Mus musculus GN=Atp6v0b PE=1 SV=1 14 195 2.0E-60
sp|Q2TA24|VATO_BOVIN V-type proton ATPase 21 kDa proteolipid subunit OS=Bos taurus GN=ATP6V0B PE=2 SV=1 14 195 3.0E-60
sp|Q99437|VATO_HUMAN V-type proton ATPase 21 kDa proteolipid subunit OS=Homo sapiens GN=ATP6V0B PE=2 SV=1 27 195 5.0E-60
sp|Q9SZY7|VATO1_ARATH V-type proton ATPase subunit c''1 OS=Arabidopsis thaliana GN=VHA-c''1 PE=1 SV=1 27 195 7.0E-59
sp|Q9SLA2|VATO2_ARATH V-type proton ATPase subunit c''2 OS=Arabidopsis thaliana GN=VHA-c''2 PE=1 SV=1 28 195 4.0E-58
sp|P54642|VATL_DICDI V-type proton ATPase proteolipid subunit OS=Dictyostelium discoideum GN=vatP PE=2 SV=1 23 201 8.0E-19
sp|Q43362|VATL_CHRCT V-type proton ATPase 16 kDa proteolipid subunit OS=Chrysotila carteri GN=VAP PE=2 SV=1 47 196 9.0E-19
sp|Q96473|VATL_KALDA V-type proton ATPase 16 kDa proteolipid subunit OS=Kalanchoe daigremontiana PE=2 SV=1 37 194 4.0E-18
sp|P59229|VATL4_ARATH V-type proton ATPase subunit c4 OS=Arabidopsis thaliana GN=VHA-c4 PE=2 SV=1 37 194 4.0E-18
sp|P68161|VATL_MESCR V-type proton ATPase 16 kDa proteolipid subunit OS=Mesembryanthemum crystallinum GN=VMAC1 PE=2 SV=1 37 194 4.0E-18
sp|P68162|VATL_BETVU V-type proton ATPase 16 kDa proteolipid subunit OS=Beta vulgaris GN=VMAC1 PE=2 SV=1 37 194 4.0E-18
sp|Q43434|VATL_GOSHI V-type proton ATPase 16 kDa proteolipid subunit OS=Gossypium hirsutum GN=CVA16-2 PE=2 SV=1 37 194 4.0E-18
sp|O22552|VATL_VIGRR V-type proton ATPase 16 kDa proteolipid subunit OS=Vigna radiata var. radiata PE=2 SV=1 37 194 4.0E-18
sp|P59228|VATL2_ARATH V-type proton ATPase subunit c2 OS=Arabidopsis thaliana GN=VHA-c2 PE=2 SV=1 37 194 4.0E-18
sp|P0DH94|VATL5_ARATH V-type proton ATPase subunit c5 OS=Arabidopsis thaliana GN=VHA-c5 PE=2 SV=1 37 194 4.0E-18
sp|P0DH93|VATL3_ARATH V-type proton ATPase subunit c3 OS=Arabidopsis thaliana GN=VHA-c3 PE=1 SV=1 37 194 4.0E-18
sp|P0DH92|VATL1_ARATH V-type proton ATPase subunit c1 OS=Arabidopsis thaliana GN=VHA-c1 PE=2 SV=1 37 194 4.0E-18
sp|P31413|VATL_NEUCR V-type proton ATPase 16 kDa proteolipid subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-3 PE=2 SV=1 40 195 5.0E-18
sp|Q00607|VATL_CANTR V-type proton ATPase 16 kDa proteolipid subunit OS=Candida tropicalis GN=VMA3 PE=3 SV=1 40 195 7.0E-18
sp|O24011|VATL_SOLLC V-type proton ATPase 16 kDa proteolipid subunit OS=Solanum lycopersicum PE=2 SV=1 37 194 1.0E-17
sp|Q40585|VATL_TOBAC V-type proton ATPase 16 kDa proteolipid subunit OS=Nicotiana tabacum PE=2 SV=1 37 194 1.0E-17
sp|Q0IUB5|VATL_ORYSJ V-type proton ATPase 16 kDa proteolipid subunit OS=Oryza sativa subsp. japonica GN=VATP-P1 PE=2 SV=1 37 194 2.0E-17
sp|A2ZBW5|VATL_ORYSI V-type proton ATPase 16 kDa proteolipid subunit OS=Oryza sativa subsp. indica GN=VATP-P1 PE=2 SV=1 37 194 2.0E-17
sp|P23957|VATL_AVESA V-type proton ATPase 16 kDa proteolipid subunit OS=Avena sativa GN=VATP-P1 PE=2 SV=1 37 194 3.0E-17
sp|P34546|VATL2_CAEEL V-type proton ATPase 16 kDa proteolipid subunit 2/3 OS=Caenorhabditis elegans GN=vha-2 PE=2 SV=2 36 190 8.0E-17
sp|Q17046|VATL_ASCSU V-type proton ATPase 16 kDa proteolipid subunit OS=Ascaris suum GN=12 PE=3 SV=1 47 190 1.0E-16
sp|P23956|VATL_BOVIN V-type proton ATPase 16 kDa proteolipid subunit OS=Bos taurus GN=ATP6V0C PE=1 SV=1 44 193 1.0E-16
sp|O18882|VATL_SHEEP V-type proton ATPase 16 kDa proteolipid subunit OS=Ovis aries GN=ATP6V0C PE=2 SV=1 44 193 1.0E-16
sp|Q612A5|VATL2_CAEBR V-type proton ATPase 16 kDa proteolipid subunit 2/3 OS=Caenorhabditis briggsae GN=vha-2 PE=3 SV=1 36 190 1.0E-16
sp|P50515|VATL_SCHPO V-type proton ATPase 16 kDa proteolipid subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma3 PE=3 SV=1 47 195 2.0E-16
sp|P63081|VATL_RAT V-type proton ATPase 16 kDa proteolipid subunit OS=Rattus norvegicus GN=Atp6v0c PE=2 SV=1 47 193 3.0E-16
sp|P63082|VATL_MOUSE V-type proton ATPase 16 kDa proteolipid subunit OS=Mus musculus GN=Atp6v0c PE=1 SV=1 47 193 3.0E-16
sp|P23380|VATL_DROME V-type proton ATPase 16 kDa proteolipid subunit OS=Drosophila melanogaster GN=Vha16-1 PE=2 SV=1 47 193 1.0E-15
sp|P27449|VATL_HUMAN V-type proton ATPase 16 kDa proteolipid subunit OS=Homo sapiens GN=ATP6V0C PE=1 SV=1 44 193 2.0E-15
sp|P25515|VATL1_YEAST V-type proton ATPase subunit c OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA3 PE=1 SV=1 40 195 3.0E-15
sp|Q26250|VATL_NEPNO V-type proton ATPase 16 kDa proteolipid subunit OS=Nephrops norvegicus PE=2 SV=1 40 195 3.0E-15
sp|P55277|VATL_HELVI V-type proton ATPase 16 kDa proteolipid subunit OS=Heliothis virescens GN=VHA16 PE=2 SV=1 47 193 3.0E-15
sp|P31403|VATL_MANSE V-type proton ATPase 16 kDa proteolipid subunit OS=Manduca sexta GN=VHA16 PE=2 SV=1 47 193 4.0E-15
sp|O16110|VATL_AEDAE V-type proton ATPase 16 kDa proteolipid subunit OS=Aedes aegypti GN=AAEL000291 PE=2 SV=2 47 193 7.0E-15
sp|Q03105|VATL_TORMA V-type proton ATPase 16 kDa proteolipid subunit OS=Torpedo marmorata PE=1 SV=1 56 193 2.0E-14
sp|Q9URZ8|VATL2_SCHPO V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma11 PE=3 SV=1 56 195 8.0E-14
sp|Q6FUY5|VATL2_CANGA V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VMA11 PE=3 SV=1 48 195 2.0E-13
sp|Q24808|VATL_ENTDI V-type proton ATPase 16 kDa proteolipid subunit OS=Entamoeba dispar GN=VMA3 PE=2 SV=1 40 195 4.0E-13
sp|Q21898|VATL1_CAEEL V-type proton ATPase 16 kDa proteolipid subunit 1 OS=Caenorhabditis elegans GN=vha-1 PE=2 SV=1 62 190 1.0E-12
sp|Q41773|VATL_MAIZE V-type proton ATPase 16 kDa proteolipid subunit (Fragment) OS=Zea mays PE=2 SV=2 87 194 3.0E-12
sp|Q6BSB9|VATL2_DEBHA V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VMA11 PE=3 SV=1 55 195 4.0E-12
sp|Q24810|VATL_ENTHI V-type proton ATPase 16 kDa proteolipid subunit OS=Entamoeba histolytica GN=VMA3 PE=3 SV=1 36 191 6.0E-12
sp|P32842|VATL2_YEAST V-type proton ATPase subunit c' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA11 PE=1 SV=1 48 195 6.0E-12
sp|Q6CT28|VATL2_KLULA V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VMA11 PE=3 SV=1 48 195 8.0E-12
sp|Q9Y874|VATL2_NEUCR V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-11 PE=2 SV=2 48 195 2.0E-11
sp|Q755G4|VATL2_ASHGO V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA11 PE=3 SV=1 32 195 3.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0015991 ATP hydrolysis coupled proton transport Yes
GO:0015078 proton transmembrane transporter activity Yes
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain Yes
GO:0008324 cation transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0099132 ATP hydrolysis coupled cation transmembrane transport No
GO:0032991 protein-containing complex No
GO:0051234 establishment of localization No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0015672 monovalent inorganic cation transport No
GO:0006812 cation transport No
GO:1902600 proton transmembrane transport No
GO:0055085 transmembrane transport No
GO:0051179 localization No
GO:0090662 ATP hydrolysis coupled transmembrane transport No
GO:0044425 membrane part No
GO:0098660 inorganic ion transmembrane transport No
GO:0099131 ATP hydrolysis coupled ion transmembrane transport No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0003674 molecular_function No
GO:0015988 energy coupled proton transmembrane transport, against electrochemical gradient No
GO:0098796 membrane protein complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 44 66 22
3 86 108 22
4 128 150 22
5 170 192 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9251
MSLVYGLGGVGSFLTVVGAYMLFTGSGEAFNVGAFLESISPYAWADMGIALCIGLSVVGAAWGIFITGSSILGAG
VKAPRIRTKNLISIIFCEVVAIYGVIMSIVFSSKVSLVDGAEAFSANSYYTGYALFWSGITVGLCNLVCGVAVGI
NGSGAALADAADASLFVKILVIEIFSSVLGLFGLIIGLLVSGKANPFGSNQ*
Coding >Hirsu2|9251
ATGAGCCTCGTGTATGGCCTGGGCGGCGTCGGCTCATTCCTGACCGTCGTGGGAGCTTATATGCTCTTTACCGGC
AGCGGTGAGGCCTTCAACGTCGGCGCCTTTCTTGAGTCCATCTCCCCATACGCCTGGGCAGACATGGGCATCGCC
CTGTGCATCGGACTGTCTGTCGTCGGCGCGGCCTGGGGCATCTTTATCACCGGCTCCTCCATTCTCGGCGCAGGC
GTCAAGGCCCCCCGCATCCGGACGAAGAACCTCATCTCCATAATCTTCTGCGAGGTCGTCGCCATCTACGGCGTC
ATCATGTCCATCGTCTTCTCCTCCAAGGTCAGCCTTGTCGATGGCGCCGAGGCCTTCTCCGCCAACTCGTACTAC
ACCGGCTACGCCCTCTTCTGGTCCGGCATCACCGTCGGTCTCTGCAACCTCGTCTGCGGCGTCGCCGTCGGCATC
AACGGTAGCGGCGCTGCTCTGGCAGATGCCGCCGATGCTTCTCTATTTGTCAAAATTCTTGTCATTGAGATTTTC
AGCTCGGTTCTCGGTCTCTTCGGCCTCATCATAGGCCTGCTCGTCTCCGGAAAGGCCAACCCCTTCGGCTCGAAC
CAGTAA
Transcript >Hirsu2|9251
ATGAGCCTCGTGTATGGCCTGGGCGGCGTCGGCTCATTCCTGACCGTCGTGGGAGCTTATATGCTCTTTACCGGC
AGCGGTGAGGCCTTCAACGTCGGCGCCTTTCTTGAGTCCATCTCCCCATACGCCTGGGCAGACATGGGCATCGCC
CTGTGCATCGGACTGTCTGTCGTCGGCGCGGCCTGGGGCATCTTTATCACCGGCTCCTCCATTCTCGGCGCAGGC
GTCAAGGCCCCCCGCATCCGGACGAAGAACCTCATCTCCATAATCTTCTGCGAGGTCGTCGCCATCTACGGCGTC
ATCATGTCCATCGTCTTCTCCTCCAAGGTCAGCCTTGTCGATGGCGCCGAGGCCTTCTCCGCCAACTCGTACTAC
ACCGGCTACGCCCTCTTCTGGTCCGGCATCACCGTCGGTCTCTGCAACCTCGTCTGCGGCGTCGCCGTCGGCATC
AACGGTAGCGGCGCTGCTCTGGCAGATGCCGCCGATGCTTCTCTATTTGTCAAAATTCTTGTCATTGAGATTTTC
AGCTCGGTTCTCGGTCTCTTCGGCCTCATCATAGGCCTGCTCGTCTCCGGAAAGGCCAACCCCTTCGGCTCGAAC
CAGTAA
Gene >Hirsu2|9251
ATGAGCCTCGTGTATGGCCTGGGCGGCGTCGGCTCATTCCTGACCGTCGTGGGAGCTTGTACGTTGATTACCTCC
CGACTCCGCGAGCAGCACACCCAGAACACTTGGGCACGGCCCTGAACCCCTCCGATGAAGGGCCAGGGGGAAGAG
GGAGGGGGAGTGGGGCGGAGGAAGGAAGATTGGGATGGGATGAGAGATCGGTCTTCTAGGAAACGAGGGAAATCC
GGTGCGGCTGACGAGTGGCGTCCTCGCAGATATGCTCTTTACCGGCAGCGGTGAGGCCTTCAACGTCGGCGCCTT
TCTTGAGTCCATCTCCCCATACGCCTGGGCAGACATGGGCATCGCCCTGTGCATCGGACTGTCTGTCGTCGGCGC
GGCCTGGTAGGACGCTCCGCAATTCTCTTTCCGCCGCGAGGGGGCGCGCGCCTGCTGACCGGCTGCAGGGGCATC
TTTATCACCGGCTCCTCCATTCTCGGCGCAGGCGTCAAGGCCCCCCGCATCCGGACGAAGAACCTCATCTCCATA
ATCTTCTGCGAGGTCGTCGCCATCTACGGCGTCATCATGTCCATCGTCTTCTCCTCCAAGGTCAGCCTTGTCGAT
GGCGCCGAGGCCTTCTCCGCCAACTCGTACTACACCGGCTACGCCCTCTTCTGGTCCGGCATCACCGTCGGTCTC
TGCAACCTCGTCTGCGGCGTCGCCGTCGGCATCAACGGTAGCGGCGCTGCTCTGGCAGATGCCGCCGATGCTTCT
CTGTACGTGCCCCCCCCCCCTTCTCCACCAAACACCGACCGCATCCCTGGCCCCCCTTTTGCGAACCTCGCTCTC
CAACGTGATATCGATTTAAATACTAACGCCCAAACGCAGATTTGTCAAAATTCTTGTCATTGAGATTTTCAGCTC
GGTTCTCGGTCTCTTCGGCCTCATCATAGGCCTGCTCGTCTCCGGAAAGGCCAACCCCTTCGGCTCGAACCAGTA
A

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail