Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9250
Gene name
LocationContig_660:941..1502
Strand-
Gene length (bp)561
Transcript length (bp)345
Coding sequence length (bp)345
Protein length (aa) 115

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit 2.0E-24 63 108
PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain 4.3E-24 8 55

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7ZPG2|T2AG_NECH7 Transcription initiation factor IIA subunit 2 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=toa2 PE=3 SV=1 1 111 4.0E-72
sp|A4QW40|T2AG_MAGO7 Transcription initiation factor IIA subunit 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TOA2 PE=3 SV=1 1 112 5.0E-58
sp|Q5BB99|T2AG_EMENI Transcription initiation factor IIA subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=toa2 PE=3 SV=1 5 113 8.0E-53
sp|O74948|T2AG_SCHPO Transcription initiation factor IIA subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=toa2 PE=3 SV=2 8 109 2.0E-43
sp|P0CR84|T2AG_CRYNJ Transcription initiation factor IIA subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TOA2 PE=3 SV=1 3 108 3.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7ZPG2|T2AG_NECH7 Transcription initiation factor IIA subunit 2 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=toa2 PE=3 SV=1 1 111 4.0E-72
sp|A4QW40|T2AG_MAGO7 Transcription initiation factor IIA subunit 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TOA2 PE=3 SV=1 1 112 5.0E-58
sp|Q5BB99|T2AG_EMENI Transcription initiation factor IIA subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=toa2 PE=3 SV=1 5 113 8.0E-53
sp|O74948|T2AG_SCHPO Transcription initiation factor IIA subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=toa2 PE=3 SV=2 8 109 2.0E-43
sp|P0CR84|T2AG_CRYNJ Transcription initiation factor IIA subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TOA2 PE=3 SV=1 3 108 3.0E-33
sp|P0CR85|T2AG_CRYNB Transcription initiation factor IIA subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TOA2 PE=3 SV=1 3 108 3.0E-33
sp|Q54ND1|T2AG_DICDI Transcription initiation factor IIA subunit 2 OS=Dictyostelium discoideum GN=gtf2a2 PE=3 SV=1 6 108 4.0E-33
sp|P32774|T2AG_YEAST Transcription initiation factor IIA subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOA2 PE=1 SV=1 8 110 2.0E-32
sp|Q0DLD3|T2AG_ORYSJ Transcription initiation factor IIA subunit 2 OS=Oryza sativa subsp. japonica GN=TFIIAy PE=3 SV=1 9 109 3.0E-32
sp|A2XZI2|T2AG_ORYSI Transcription initiation factor IIA subunit 2 OS=Oryza sativa subsp. indica GN=TFIIAy PE=3 SV=2 9 109 3.0E-32
sp|Q39236|T2AG_ARATH Transcription initiation factor IIA subunit 2 OS=Arabidopsis thaliana GN=TFIIA-S PE=2 SV=2 9 109 4.0E-31
sp|O08950|T2AG_RAT Transcription initiation factor IIA subunit 2 OS=Rattus norvegicus GN=Gtf2a2 PE=3 SV=1 9 112 6.0E-31
sp|Q80ZM7|T2AG_MOUSE Transcription initiation factor IIA subunit 2 OS=Mus musculus GN=Gtf2a2 PE=1 SV=2 9 112 6.0E-31
sp|P52657|T2AG_HUMAN Transcription initiation factor IIA subunit 2 OS=Homo sapiens GN=GTF2A2 PE=1 SV=1 9 112 7.0E-31
sp|Q90YG6|T2AG_ONCMY Transcription initiation factor IIA subunit 2 OS=Oncorhynchus mykiss GN=gtf2a2 PE=3 SV=1 9 112 1.0E-30
sp|Q9IA78|T2AG_PAROL Transcription initiation factor IIA subunit 2 OS=Paralichthys olivaceus GN=gtf2a2 PE=3 SV=1 9 109 3.0E-29
sp|B7Q1Q9|T2AG_IXOSC Transcription initiation factor IIA subunit 2 OS=Ixodes scapularis GN=IscW_ISCW010050 PE=3 SV=1 9 109 3.0E-28
sp|P52656|T2AG_DROME Transcription initiation factor IIA subunit 2 OS=Drosophila melanogaster GN=TfIIA-S PE=1 SV=1 9 109 4.0E-25
sp|Q9NEX2|T2AG_CAEEL Transcription initiation factor IIA subunit 2 OS=Caenorhabditis elegans GN=Y111B2A.13 PE=3 SV=2 9 114 2.0E-20
sp|C4QGM3|T2AG_SCHMA Transcription initiation factor IIA subunit 2 OS=Schistosoma mansoni GN=Smp_071830 PE=3 SV=2 7 105 1.0E-19
sp|Q9BIB4|YMYD_CAEEL Transcription initiation factor IIA small chain homolog OS=Caenorhabditis elegans GN=B0336.13 PE=3 SV=1 7 110 2.0E-18
sp|Q9W5B9|T2AH_DROME Transcription initiation factor IIA subunit 2-2 OS=Drosophila melanogaster GN=TfIIA-S-2 PE=3 SV=1 9 112 6.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0005672 transcription factor TFIIA complex Yes
GO:0044428 nuclear part No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006352 DNA-templated transcription, initiation No
GO:0016070 RNA metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005667 transcription factor complex No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0044422 organelle part No
GO:0005575 cellular_component No
GO:0044424 intracellular part No
GO:0019438 aromatic compound biosynthetic process No
GO:0009987 cellular process No
GO:0044451 nucleoplasm part No
GO:0018130 heterocycle biosynthetic process No
GO:0044798 nuclear transcription factor complex No
GO:0032991 protein-containing complex No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0090575 RNA polymerase II transcription factor complex No
GO:0044446 intracellular organelle part No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0044464 cell part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9250
MATGAQSFYELYRRSSIGLALTDTLDDLISDERINPQLAMKILGNFDQAITETLQKSVKSRLQFKGSLDTYRFCD
EVWTFLIKNVTFKMDNGSQSVQADKVKIVSCNAKKPGEV*
Coding >Hirsu2|9250
ATGGCGACGGGTGCGCAGTCATTCTACGAGCTCTACCGTAGGAGCAGTATCGGGCTCGCGTTGACTGACACGCTC
GACGATCTCATTAGCGACGAGCGCATCAATCCGCAGCTGGCGATGAAGATCCTCGGCAACTTCGACCAGGCCATC
ACGGAGACGCTTCAGAAGAGCGTCAAGAGCCGGCTTCAGTTTAAGGGAAGCCTGGACACGTATCGCTTCTGCGAC
GAAGTCTGGACCTTTCTCATCAAGAACGTGACGTTCAAGATGGACAACGGCAGCCAGTCGGTGCAGGCGGACAAG
GTCAAGATTGTGAGCTGCAACGCCAAGAAGCCGGGAGAGGTGTAG
Transcript >Hirsu2|9250
ATGGCGACGGGTGCGCAGTCATTCTACGAGCTCTACCGTAGGAGCAGTATCGGGCTCGCGTTGACTGACACGCTC
GACGATCTCATTAGCGACGAGCGCATCAATCCGCAGCTGGCGATGAAGATCCTCGGCAACTTCGACCAGGCCATC
ACGGAGACGCTTCAGAAGAGCGTCAAGAGCCGGCTTCAGTTTAAGGGAAGCCTGGACACGTATCGCTTCTGCGAC
GAAGTCTGGACCTTTCTCATCAAGAACGTGACGTTCAAGATGGACAACGGCAGCCAGTCGGTGCAGGCGGACAAG
GTCAAGATTGTGAGCTGCAACGCCAAGAAGCCGGGAGAGGTGTAG
Gene >Hirsu2|9250
ATGGCGACGGGTGCGCAGTCATTCTACGAGCTCTACCGTAGGAGCAGGTACGGATCCACGGCGGCGCAGGTTGCG
TTCCGGGTCGGCTCGCACGCCTGCTCGGGCGGGCTGGCGGGACCGACCGGCTGGGCGGCGATGAAGCTTGTGGAC
AGGAGATGCTGACGAACGTTGTCTCTCTCGCACCGCTCTAGTATCGGGCTCGCGTTGACTGACACGCTCGACGAT
CTCATTAGCGACGAGCGCATCAATCCGCAGCTGGCGATGAAGATCCTCGGCAACTTCGACCAGGCCATCACGGAG
ACGCTTCAGAAGAGCGTCAAGAGCCGGCTTCAGTTTAAGGTGAGTGGCTGCAACGAGCGCGGGCGAACGACACAA
GAGGCTGACCGGTTTGGGGGTGGGAAACGTCTACAGGGAAGCCTGGACACGTATCGCTTCTGCGACGAAGTCTGG
ACCTTTCTCATCAAGAACGTGACGTTCAAGATGGACAACGGCAGCCAGTCGGTGCAGGCGGACAAGGTCAAGATT
GTGAGCTGCAACGCCAAGAAGCCGGGAGAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail