Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9241
Gene name
LocationContig_66:13769..17032
Strand+
Gene length (bp)3263
Transcript length (bp)3039
Coding sequence length (bp)3039
Protein length (aa) 1013

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.9E-65 71 332
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.9E-38 73 322

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 36 354 6.0E-70
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 77 384 2.0E-69
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 71 334 2.0E-65
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 37 365 1.0E-63
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 52 340 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 36 354 6.0E-70
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 77 384 2.0E-69
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 71 334 2.0E-65
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 37 365 1.0E-63
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 52 340 1.0E-63
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 52 340 2.0E-62
sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 50 344 6.0E-62
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 54 340 8.0E-62
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 46 332 1.0E-61
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 76 340 7.0E-61
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 76 340 2.0E-60
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 64 338 4.0E-60
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 64 338 5.0E-60
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 64 338 7.0E-60
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 64 338 8.0E-60
sp|P62205|PLK1_XENTR Serine/threonine-protein kinase PLK1 OS=Xenopus tropicalis GN=plk1 PE=2 SV=1 76 340 1.0E-59
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 50 344 7.0E-59
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 59 347 1.0E-58
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 57 344 2.0E-58
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 57 344 2.0E-58
sp|Q20845|PLK3_CAEEL Serine/threonine-protein kinase plk-3 OS=Caenorhabditis elegans GN=plk-3 PE=2 SV=1 45 366 1.0E-55
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 71 332 4.0E-53
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 64 352 5.0E-53
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 71 314 5.0E-47
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 71 343 4.0E-46
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 71 314 1.0E-45
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 71 343 2.0E-45
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 71 314 7.0E-45
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 71 349 2.0E-44
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 70 356 9.0E-44
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 71 343 8.0E-42
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 71 318 1.0E-41
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 71 343 2.0E-41
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 71 403 1.0E-40
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 71 332 2.0E-40
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 69 329 3.0E-40
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 71 332 4.0E-40
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 19 315 6.0E-40
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 71 335 6.0E-40
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 71 332 7.0E-40
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 71 332 8.0E-40
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 71 332 2.0E-39
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 19 315 2.0E-39
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 71 332 2.0E-39
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 25 314 2.0E-39
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 71 332 5.0E-39
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 71 332 7.0E-39
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 51 320 8.0E-39
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 71 333 8.0E-39
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 71 350 1.0E-38
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 71 333 2.0E-38
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 71 333 2.0E-38
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 71 338 6.0E-38
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 59 314 7.0E-38
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 71 336 7.0E-38
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 71 340 9.0E-38
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 71 336 9.0E-38
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 71 339 1.0E-37
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 14 338 1.0E-37
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 71 315 2.0E-37
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 71 338 2.0E-37
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 71 350 2.0E-37
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 25 314 2.0E-37
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 71 366 3.0E-37
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 71 352 4.0E-37
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 71 333 4.0E-37
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 71 329 4.0E-37
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 69 329 5.0E-37
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 71 340 5.0E-37
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 71 332 5.0E-37
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 69 325 5.0E-37
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 71 338 6.0E-37
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 71 315 6.0E-37
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 71 332 6.0E-37
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 71 339 9.0E-37
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 51 334 1.0E-36
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 64 336 1.0E-36
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 64 336 1.0E-36
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 71 361 1.0E-36
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 64 336 1.0E-36
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 62 293 2.0E-36
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 62 293 2.0E-36
sp|Q9BXA7|TSSK1_HUMAN Testis-specific serine/threonine-protein kinase 1 OS=Homo sapiens GN=TSSK1B PE=1 SV=1 71 333 2.0E-36
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 71 323 2.0E-36
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 64 336 2.0E-36
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 64 357 2.0E-36
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 69 333 2.0E-36
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 71 333 2.0E-36
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 71 335 3.0E-36
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 71 336 3.0E-36
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 64 336 3.0E-36
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 64 357 3.0E-36
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 71 342 3.0E-36
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 64 360 3.0E-36
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 71 338 3.0E-36
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 71 315 4.0E-36
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 71 326 5.0E-36
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 71 315 5.0E-36
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 71 345 5.0E-36
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 6 335 7.0E-36
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 62 293 9.0E-36
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 71 341 1.0E-35
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 71 315 1.0E-35
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 71 341 1.0E-35
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 71 338 1.0E-35
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 71 338 1.0E-35
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 42 333 2.0E-35
sp|Q9D411|TSSK4_MOUSE Testis-specific serine/threonine-protein kinase 4 OS=Mus musculus GN=Tssk4 PE=2 SV=1 71 320 2.0E-35
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 71 336 2.0E-35
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 71 336 2.0E-35
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 71 315 2.0E-35
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 71 336 2.0E-35
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 71 328 2.0E-35
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 71 338 2.0E-35
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 71 344 2.0E-35
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 71 345 3.0E-35
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 61 314 3.0E-35
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 56 314 3.0E-35
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 71 336 3.0E-35
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 71 339 3.0E-35
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 53 315 3.0E-35
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 71 323 3.0E-35
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 71 342 3.0E-35
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 71 342 3.0E-35
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 56 349 4.0E-35
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 66 334 4.0E-35
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 55 333 4.0E-35
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 71 334 5.0E-35
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 59 334 5.0E-35
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 38 321 5.0E-35
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 55 362 6.0E-35
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 71 334 6.0E-35
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 71 333 6.0E-35
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 71 349 7.0E-35
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 27 336 9.0E-35
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 37 334 1.0E-34
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 71 333 1.0E-34
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 71 335 1.0E-34
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 71 548 1.0E-34
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 42 380 1.0E-34
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 71 315 1.0E-34
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 71 336 2.0E-34
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 71 293 2.0E-34
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 61 333 2.0E-34
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 71 293 2.0E-34
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 58 351 2.0E-34
sp|Q6SA08|TSSK4_HUMAN Testis-specific serine/threonine-protein kinase 4 OS=Homo sapiens GN=TSSK4 PE=1 SV=1 71 349 2.0E-34
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 71 340 2.0E-34
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 71 314 2.0E-34
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 71 320 3.0E-34
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 71 336 3.0E-34
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 65 333 3.0E-34
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 71 336 4.0E-34
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 71 336 4.0E-34
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 71 314 4.0E-34
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 71 335 5.0E-34
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 71 315 5.0E-34
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 71 352 6.0E-34
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 71 338 7.0E-34
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 71 333 8.0E-34
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 71 335 9.0E-34
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 37 320 1.0E-33
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 46 314 1.0E-33
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 60 336 1.0E-33
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 71 334 1.0E-33
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 70 315 2.0E-33
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 75 347 2.0E-33
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 71 373 2.0E-33
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 71 342 2.0E-33
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 75 347 2.0E-33
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 75 347 2.0E-33
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 71 334 3.0E-33
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 71 336 3.0E-33
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 71 338 4.0E-33
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 71 314 5.0E-33
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 70 282 5.0E-33
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 60 333 5.0E-33
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 67 315 6.0E-33
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 71 333 7.0E-33
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 58 333 7.0E-33
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 71 334 7.0E-33
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 58 333 7.0E-33
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 71 338 8.0E-33
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 59 354 8.0E-33
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 71 315 8.0E-33
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 71 370 8.0E-33
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 71 340 8.0E-33
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 55 314 8.0E-33
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 54 314 9.0E-33
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 71 334 1.0E-32
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 71 333 1.0E-32
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 68 281 1.0E-32
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 71 336 1.0E-32
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 71 334 1.0E-32
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 71 342 1.0E-32
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 71 382 1.0E-32
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 71 314 1.0E-32
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 58 351 2.0E-32
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 41 333 2.0E-32
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 49 333 2.0E-32
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 71 340 2.0E-32
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 60 334 2.0E-32
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 71 350 2.0E-32
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 71 342 3.0E-32
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 71 320 3.0E-32
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 71 357 3.0E-32
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 35 341 3.0E-32
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 71 380 3.0E-32
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 71 314 4.0E-32
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 61 333 4.0E-32
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 71 314 4.0E-32
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 61 333 4.0E-32
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 38 315 4.0E-32
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 71 338 5.0E-32
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 71 334 5.0E-32
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 41 334 5.0E-32
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 71 338 5.0E-32
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 71 314 5.0E-32
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 50 357 5.0E-32
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 71 314 5.0E-32
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 71 314 6.0E-32
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 54 314 6.0E-32
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 49 325 7.0E-32
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 71 315 7.0E-32
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 75 332 7.0E-32
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 71 336 8.0E-32
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 60 334 1.0E-31
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 38 314 1.0E-31
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 71 315 1.0E-31
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 51 314 1.0E-31
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 71 332 1.0E-31
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 71 308 2.0E-31
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 71 336 2.0E-31
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 71 293 2.0E-31
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 68 281 2.0E-31
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 71 336 2.0E-31
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 18 314 2.0E-31
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 42 314 2.0E-31
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 71 320 2.0E-31
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 77 284 3.0E-31
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 71 333 3.0E-31
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 50 333 3.0E-31
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 71 335 3.0E-31
sp|Q9LYQ8|CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana GN=CIPK2 PE=1 SV=1 71 335 3.0E-31
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 71 273 3.0E-31
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 71 335 3.0E-31
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 71 380 3.0E-31
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 71 273 3.0E-31
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 71 273 4.0E-31
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 71 273 4.0E-31
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 71 337 4.0E-31
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 71 349 4.0E-31
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 71 314 4.0E-31
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 71 335 4.0E-31
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 71 333 5.0E-31
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 71 333 5.0E-31
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 71 296 5.0E-31
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 76 333 5.0E-31
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 77 315 5.0E-31
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 71 281 5.0E-31
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 71 333 5.0E-31
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 65 333 5.0E-31
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 48 314 6.0E-31
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 71 334 6.0E-31
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 65 333 6.0E-31
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 65 333 6.0E-31
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 47 314 6.0E-31
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 71 293 6.0E-31
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 71 335 6.0E-31
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 43 314 6.0E-31
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 75 332 7.0E-31
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 75 332 7.0E-31
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 71 335 8.0E-31
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 71 435 8.0E-31
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 71 335 8.0E-31
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 77 315 1.0E-30
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 75 334 1.0E-30
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 56 334 1.0E-30
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 50 314 1.0E-30
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 71 336 1.0E-30
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 101 365 1.0E-30
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 71 315 1.0E-30
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 76 281 1.0E-30
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 71 273 1.0E-30
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 71 273 1.0E-30
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 71 333 1.0E-30
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 71 273 1.0E-30
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 71 273 2.0E-30
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 75 334 2.0E-30
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 71 333 2.0E-30
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 68 340 2.0E-30
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 71 348 2.0E-30
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 65 333 2.0E-30
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 55 314 2.0E-30
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 71 272 2.0E-30
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 69 293 2.0E-30
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 65 333 2.0E-30
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 71 360 2.0E-30
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 71 454 2.0E-30
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 67 287 2.0E-30
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 71 315 2.0E-30
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 71 333 2.0E-30
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 50 332 2.0E-30
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 65 334 2.0E-30
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 60 332 3.0E-30
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 71 333 3.0E-30
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 98 315 3.0E-30
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 70 329 3.0E-30
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 71 352 3.0E-30
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 71 383 3.0E-30
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 71 352 3.0E-30
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 71 332 3.0E-30
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 61 334 3.0E-30
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 60 332 3.0E-30
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 71 336 3.0E-30
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 71 334 3.0E-30
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 71 314 3.0E-30
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 75 334 4.0E-30
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 71 334 4.0E-30
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 71 469 4.0E-30
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 71 352 4.0E-30
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 70 333 4.0E-30
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 71 352 4.0E-30
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 15 334 4.0E-30
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 56 357 5.0E-30
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 54 329 5.0E-30
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 61 333 5.0E-30
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 54 329 5.0E-30
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 71 314 5.0E-30
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 71 336 6.0E-30
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 70 329 6.0E-30
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 71 314 6.0E-30
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 71 331 6.0E-30
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 71 314 7.0E-30
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 71 334 7.0E-30
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 3 315 8.0E-30
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 71 314 8.0E-30
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 71 314 8.0E-30
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 69 329 9.0E-30
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 71 314 9.0E-30
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 61 294 9.0E-30
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 71 335 9.0E-30
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 60 332 9.0E-30
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 61 294 9.0E-30
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 71 336 1.0E-29
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 71 337 1.0E-29
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 3 315 1.0E-29
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 41 334 1.0E-29
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 71 277 1.0E-29
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 71 339 1.0E-29
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 71 345 1.0E-29
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 55 314 1.0E-29
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 70 333 1.0E-29
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 71 314 1.0E-29
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 75 334 1.0E-29
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 71 348 1.0E-29
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 70 333 1.0E-29
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 71 314 1.0E-29
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 70 333 2.0E-29
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 73 315 2.0E-29
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 55 320 2.0E-29
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 71 333 2.0E-29
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 71 356 2.0E-29
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 65 315 2.0E-29
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 70 329 2.0E-29
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 75 334 2.0E-29
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 61 332 2.0E-29
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 74 336 2.0E-29
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 65 315 2.0E-29
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 43 314 2.0E-29
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 75 332 2.0E-29
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 65 315 2.0E-29
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 50 333 2.0E-29
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 71 329 2.0E-29
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 71 314 2.0E-29
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 71 333 2.0E-29
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 65 333 2.0E-29
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 65 333 2.0E-29
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 65 333 2.0E-29
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 70 333 2.0E-29
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 71 333 3.0E-29
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 71 333 3.0E-29
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 71 329 3.0E-29
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 69 314 3.0E-29
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 65 333 3.0E-29
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 71 329 3.0E-29
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 77 284 3.0E-29
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 71 314 3.0E-29
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 41 332 3.0E-29
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 70 357 3.0E-29
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 71 333 4.0E-29
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 71 332 4.0E-29
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 71 314 4.0E-29
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 71 333 4.0E-29
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 75 319 4.0E-29
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 71 346 4.0E-29
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 42 333 5.0E-29
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 71 346 5.0E-29
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 60 332 5.0E-29
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 74 336 5.0E-29
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 71 334 6.0E-29
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 24 329 6.0E-29
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 24 329 6.0E-29
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 71 336 6.0E-29
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 41 332 6.0E-29
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 71 315 6.0E-29
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 75 332 7.0E-29
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 71 332 7.0E-29
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 43 334 7.0E-29
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 41 332 7.0E-29
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 77 276 7.0E-29
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 71 335 8.0E-29
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 41 332 8.0E-29
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 71 333 9.0E-29
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 47 314 1.0E-28
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 71 336 1.0E-28
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 63 346 1.0E-28
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 71 315 1.0E-28
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 69 332 1.0E-28
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 60 332 1.0E-28
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 60 282 1.0E-28
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 77 284 1.0E-28
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 60 332 1.0E-28
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 71 314 1.0E-28
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 71 335 1.0E-28
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 71 293 1.0E-28
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 71 336 1.0E-28
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 62 314 1.0E-28
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 49 328 1.0E-28
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 69 332 1.0E-28
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 30 314 1.0E-28
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 77 276 1.0E-28
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 77 284 1.0E-28
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 54 335 2.0E-28
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 60 332 2.0E-28
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 69 335 2.0E-28
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 60 282 2.0E-28
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 69 331 2.0E-28
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 71 277 2.0E-28
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 71 346 2.0E-28
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 71 320 2.0E-28
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 71 315 2.0E-28
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 64 333 2.0E-28
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 71 277 2.0E-28
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 69 348 2.0E-28
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 71 314 2.0E-28
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 22 315 2.0E-28
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 71 314 2.0E-28
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 71 345 2.0E-28
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 75 315 2.0E-28
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 71 314 2.0E-28
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 68 331 2.0E-28
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 77 290 2.0E-28
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 71 314 2.0E-28
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 71 314 2.0E-28
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 34 333 2.0E-28
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 32 314 2.0E-28
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 71 334 3.0E-28
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 70 314 3.0E-28
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 61 349 3.0E-28
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 64 333 3.0E-28
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 77 290 3.0E-28
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 112 336 3.0E-28
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 75 333 3.0E-28
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 71 288 3.0E-28
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 77 290 3.0E-28
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 63 334 4.0E-28
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 71 334 4.0E-28
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 75 315 4.0E-28
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 56 314 4.0E-28
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 71 333 4.0E-28
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 76 274 4.0E-28
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 63 315 4.0E-28
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 71 332 4.0E-28
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 22 315 6.0E-28
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 63 334 7.0E-28
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 51 330 7.0E-28
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 28 334 7.0E-28
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 6 336 7.0E-28
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 49 330 7.0E-28
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 71 333 7.0E-28
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 71 314 8.0E-28
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 71 314 8.0E-28
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 71 314 8.0E-28
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 71 314 8.0E-28
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 64 334 8.0E-28
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 71 314 8.0E-28
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 71 336 8.0E-28
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 22 315 9.0E-28
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 76 274 9.0E-28
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 71 336 9.0E-28
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 71 346 1.0E-27
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 63 334 1.0E-27
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 71 314 1.0E-27
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 71 336 1.0E-27
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 42 333 1.0E-27
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 64 333 1.0E-27
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 71 333 1.0E-27
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 63 334 1.0E-27
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 71 314 1.0E-27
sp|Q4P0K0|ATG1_USTMA Serine/threonine-protein kinase ATG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG1 PE=2 SV=1 71 284 1.0E-27
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 71 345 1.0E-27
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 71 332 1.0E-27
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 55 277 1.0E-27
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 60 350 5.0E-27
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 71 329 1.0E-26
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 71 329 1.0E-26
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 71 346 2.0E-26
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 70 388 8.0E-26
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 71 346 2.0E-25
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 142 314 3.0E-24
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 45 329 7.0E-24
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 65 279 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9241
MAHRLAAARGGIDMDALSPRDANAQRAPRPAEIKTKTAAQLRAAKDKEHPPAPPAQVAEPRSSDRPDGAVYQVGK
LLGKGGFAICYSAHLLPTKQRFALKIVKSRMPPKMEQKFQTELQIHSKMRHKNVVQFFRAFSFESCTFLVLELCN
NGSLMDMVKRRKGLTEPEVRFYSIQIAGAIKYMHGKGIIHRDLKMGNIFLDAQMNAKIGDFGLAALLVTGRDMQT
IRRTTLCGTPNYIAPEILEKGKKGHDHMVDIWSLGIIMFAMVTSKPPFQSSTTDEIYRRARERDYEWPTADASQK
YISQEAKDLVATMLEDADRRPDPELIVQHAFFQSGYMPTQADMSPRLRELPPERQEFYGSRMSPSLQAQSHRNLK
QMCQECGVGPLSQENFIPTPIWKEMAAEEKAGLTPAIPLAENLVYRPFEAFLKDQKQQLRTKYASSIVSHPAPPA
ASAEDPLAAAPKAPVGLLRQPPQSFAAQQRAQNRPSAAPSKAKPQPRPLTEPAAPPPPAAQPMRARSRPEAHPEP
AVKEAAPERTRTMKSMRSSVRPVLPTTRSAPSLQVAERAAAISSEPPAPLKRHSSDSMQPATLFGPEERPVDIAG
SKPDVILERLRRLQTELERALNSRTMAIISSKTVTPPHPHIVVKWVDYTNKFGLGYILNDGSVGCILRDVPTTEG
SRSVVLPPAGVFIRGAERHILRRQDESYDDRSQPIPMTEPIRFFENNGESGLSEVSVSPEQFRVAVAPDGTAGKM
NPGRDIFQHRKRERIILWKKFANYMIAYGRDEAVPVEETEAAGVLSPGGKGAMAELVTFYQRFGDVGCWVFCDGH
LQFNFPDHTKIVLDATGTWCHFWHLPQEAAQLLAATGTIGAAALDERATLSYPLQTLLNFQAKPSASRSARASTS
RRRPEIEPALQGIPAANDFRRKVDFIKNVVKEWVANGGLGNSAMGRDTRLRWTGFRETGAGAGAGAGAAPAPQKH
VWVTIGARWGDSRLSAYVDPRRPWELLGDDVVGGSGS*
Coding >Hirsu2|9241
ATGGCTCATAGGTTGGCCGCTGCCCGTGGCGGCATCGACATGGATGCTTTGTCCCCTAGGGATGCAAATGCCCAG
CGAGCCCCCCGACCGGCCGAGATCAAGACCAAGACGGCGGCGCAGCTGAGAGCGGCGAAGGATAAGGAGCATCCT
CCGGCGCCCCCCGCGCAAGTCGCCGAGCCCCGGAGCTCCGATCGGCCAGATGGTGCCGTATATCAGGTCGGCAAG
CTGCTGGGCAAGGGGGGCTTTGCCATCTGCTACAGCGCCCATCTACTCCCGACGAAGCAGAGGTTCGCCCTGAAG
ATCGTCAAGAGCCGCATGCCGCCCAAGATGGAGCAGAAGTTCCAGACAGAGCTGCAGATACACTCCAAGATGCGG
CACAAAAACGTTGTCCAGTTCTTCAGGGCCTTCTCCTTCGAGAGCTGCACCTTTCTCGTCCTCGAGCTCTGCAAC
AACGGCTCGCTGATGGACATGGTGAAGCGACGGAAAGGCCTGACGGAGCCCGAGGTTCGCTTCTACTCGATCCAG
ATTGCCGGCGCCATCAAGTATATGCACGGCAAGGGCATCATCCACCGCGACCTTAAGATGGGCAACATCTTCCTC
GACGCTCAGATGAACGCAAAGATCGGCGACTTTGGGCTCGCCGCCTTGCTGGTCACTGGTAGGGACATGCAGACG
ATCCGGCGCACGACGCTGTGCGGCACCCCGAACTACATCGCCCCGGAGATCCTGGAGAAGGGCAAGAAGGGCCAC
GACCACATGGTGGACATTTGGAGCCTGGGCATCATCATGTTTGCCATGGTGACGTCCAAGCCGCCCTTTCAGTCC
TCGACGACGGACGAGATCTACCGCCGCGCCCGCGAACGAGACTACGAATGGCCGACGGCCGACGCTTCGCAAAAG
TACATCAGCCAGGAGGCCAAGGACCTGGTCGCGACGATGCTCGAGGACGCAGACAGGCGTCCGGACCCGGAACTC
ATCGTCCAGCACGCCTTCTTCCAGTCGGGCTACATGCCGACCCAGGCCGACATGAGCCCTCGCTTGCGCGAGCTG
CCCCCGGAGCGCCAGGAGTTCTACGGCTCGCGCATGAGCCCCTCGCTGCAGGCGCAGTCGCACCGAAACCTGAAG
CAGATGTGCCAGGAGTGCGGCGTGGGGCCCCTGAGCCAGGAGAACTTCATCCCGACGCCGATCTGGAAAGAGATG
GCGGCCGAGGAGAAGGCAGGGCTGACGCCGGCCATACCGCTGGCCGAGAACTTGGTCTACCGGCCCTTCGAGGCC
TTCCTCAAGGACCAGAAGCAGCAGCTCCGCACCAAGTACGCCTCTTCCATCGTCTCGCATCCAGCGCCGCCGGCC
GCCTCGGCAGAGGATCCGCTGGCAGCCGCACCCAAGGCACCCGTCGGCCTGCTGCGACAGCCGCCACAGAGCTTT
GCCGCCCAGCAGCGAGCGCAGAACCGGCCGTCGGCGGCCCCGTCCAAGGCGAAGCCGCAGCCTCGGCCCTTGACG
GAGCCCGCCGCGCCCCCGCCTCCCGCCGCGCAGCCGATGCGGGCGCGGTCCCGGCCGGAGGCCCACCCCGAGCCG
GCCGTCAAGGAGGCAGCGCCGGAGCGTACGCGAACCATGAAGAGCATGCGCAGCTCGGTGCGCCCCGTCCTGCCA
ACGACGAGGTCAGCCCCCAGCTTGCAGGTCGCCGAGCGGGCGGCGGCGATTTCTTCGGAGCCGCCGGCACCCCTC
AAGAGACACAGCTCGGACTCGATGCAGCCGGCGACGCTCTTCGGCCCGGAGGAGAGGCCCGTGGACATCGCGGGA
AGCAAGCCCGACGTGATCCTGGAGCGCCTGAGGCGTCTGCAGACGGAACTCGAACGGGCGCTCAACTCGCGCACC
ATGGCCATCATTTCTTCCAAGACGGTGACGCCGCCGCACCCGCACATCGTGGTCAAATGGGTCGACTACACGAAC
AAGTTCGGGCTCGGCTACATCCTCAACGACGGCAGCGTGGGCTGCATCCTGCGCGACGTGCCGACCACCGAGGGC
AGCAGGTCGGTCGTGCTCCCCCCCGCCGGCGTCTTCATCCGCGGCGCCGAGAGGCACATCCTCCGGCGCCAGGAC
GAGTCGTACGACGACAGGAGCCAGCCGATCCCCATGACGGAACCGATCAGGTTCTTCGAGAACAACGGCGAGAGC
GGGCTGTCGGAGGTGTCGGTCTCGCCCGAGCAGTTCCGGGTGGCCGTCGCCCCGGACGGCACGGCGGGCAAGATG
AATCCCGGGAGGGACATCTTCCAGCACCGGAAGCGGGAGAGGATCATCCTGTGGAAGAAGTTCGCCAACTACATG
ATTGCCTACGGCAGAGACGAAGCCGTCCCGGTCGAGGAGACGGAGGCGGCGGGCGTCTTGTCCCCGGGCGGCAAG
GGCGCGATGGCGGAGCTGGTGACGTTCTACCAGCGCTTCGGGGACGTCGGATGCTGGGTCTTTTGCGACGGCCAC
CTCCAGTTCAACTTCCCCGACCACACCAAGATCGTGCTGGACGCGACGGGCACCTGGTGCCACTTCTGGCACCTG
CCGCAGGAGGCGGCGCAGCTGCTGGCGGCGACGGGCACCATCGGGGCGGCGGCGCTGGACGAGCGGGCGACGCTG
TCGTACCCGCTGCAGACGCTGCTCAACTTCCAGGCCAAGCCGTCGGCGTCGCGGTCGGCGCGGGCGTCGACGTCG
CGGCGGCGGCCCGAGATCGAGCCGGCACTGCAGGGCATCCCGGCCGCCAACGACTTCCGGCGCAAGGTCGACTTC
ATCAAGAACGTGGTCAAGGAGTGGGTGGCCAACGGCGGGCTGGGCAACAGCGCCATGGGCCGCGACACGCGCCTG
CGCTGGACGGGCTTCCGCGAGACGGGGGCCGGGGCCGGGGCCGGGGCCGGGGCGGCGCCGGCGCCGCAGAAGCAC
GTGTGGGTCACCATCGGCGCCCGCTGGGGGGACAGCCGGCTGTCGGCGTACGTGGACCCGCGCCGGCCGTGGGAG
CTGCTGGGCGACGACGTCGTCGGCGGCTCGGGGAGCTGA
Transcript >Hirsu2|9241
ATGGCTCATAGGTTGGCCGCTGCCCGTGGCGGCATCGACATGGATGCTTTGTCCCCTAGGGATGCAAATGCCCAG
CGAGCCCCCCGACCGGCCGAGATCAAGACCAAGACGGCGGCGCAGCTGAGAGCGGCGAAGGATAAGGAGCATCCT
CCGGCGCCCCCCGCGCAAGTCGCCGAGCCCCGGAGCTCCGATCGGCCAGATGGTGCCGTATATCAGGTCGGCAAG
CTGCTGGGCAAGGGGGGCTTTGCCATCTGCTACAGCGCCCATCTACTCCCGACGAAGCAGAGGTTCGCCCTGAAG
ATCGTCAAGAGCCGCATGCCGCCCAAGATGGAGCAGAAGTTCCAGACAGAGCTGCAGATACACTCCAAGATGCGG
CACAAAAACGTTGTCCAGTTCTTCAGGGCCTTCTCCTTCGAGAGCTGCACCTTTCTCGTCCTCGAGCTCTGCAAC
AACGGCTCGCTGATGGACATGGTGAAGCGACGGAAAGGCCTGACGGAGCCCGAGGTTCGCTTCTACTCGATCCAG
ATTGCCGGCGCCATCAAGTATATGCACGGCAAGGGCATCATCCACCGCGACCTTAAGATGGGCAACATCTTCCTC
GACGCTCAGATGAACGCAAAGATCGGCGACTTTGGGCTCGCCGCCTTGCTGGTCACTGGTAGGGACATGCAGACG
ATCCGGCGCACGACGCTGTGCGGCACCCCGAACTACATCGCCCCGGAGATCCTGGAGAAGGGCAAGAAGGGCCAC
GACCACATGGTGGACATTTGGAGCCTGGGCATCATCATGTTTGCCATGGTGACGTCCAAGCCGCCCTTTCAGTCC
TCGACGACGGACGAGATCTACCGCCGCGCCCGCGAACGAGACTACGAATGGCCGACGGCCGACGCTTCGCAAAAG
TACATCAGCCAGGAGGCCAAGGACCTGGTCGCGACGATGCTCGAGGACGCAGACAGGCGTCCGGACCCGGAACTC
ATCGTCCAGCACGCCTTCTTCCAGTCGGGCTACATGCCGACCCAGGCCGACATGAGCCCTCGCTTGCGCGAGCTG
CCCCCGGAGCGCCAGGAGTTCTACGGCTCGCGCATGAGCCCCTCGCTGCAGGCGCAGTCGCACCGAAACCTGAAG
CAGATGTGCCAGGAGTGCGGCGTGGGGCCCCTGAGCCAGGAGAACTTCATCCCGACGCCGATCTGGAAAGAGATG
GCGGCCGAGGAGAAGGCAGGGCTGACGCCGGCCATACCGCTGGCCGAGAACTTGGTCTACCGGCCCTTCGAGGCC
TTCCTCAAGGACCAGAAGCAGCAGCTCCGCACCAAGTACGCCTCTTCCATCGTCTCGCATCCAGCGCCGCCGGCC
GCCTCGGCAGAGGATCCGCTGGCAGCCGCACCCAAGGCACCCGTCGGCCTGCTGCGACAGCCGCCACAGAGCTTT
GCCGCCCAGCAGCGAGCGCAGAACCGGCCGTCGGCGGCCCCGTCCAAGGCGAAGCCGCAGCCTCGGCCCTTGACG
GAGCCCGCCGCGCCCCCGCCTCCCGCCGCGCAGCCGATGCGGGCGCGGTCCCGGCCGGAGGCCCACCCCGAGCCG
GCCGTCAAGGAGGCAGCGCCGGAGCGTACGCGAACCATGAAGAGCATGCGCAGCTCGGTGCGCCCCGTCCTGCCA
ACGACGAGGTCAGCCCCCAGCTTGCAGGTCGCCGAGCGGGCGGCGGCGATTTCTTCGGAGCCGCCGGCACCCCTC
AAGAGACACAGCTCGGACTCGATGCAGCCGGCGACGCTCTTCGGCCCGGAGGAGAGGCCCGTGGACATCGCGGGA
AGCAAGCCCGACGTGATCCTGGAGCGCCTGAGGCGTCTGCAGACGGAACTCGAACGGGCGCTCAACTCGCGCACC
ATGGCCATCATTTCTTCCAAGACGGTGACGCCGCCGCACCCGCACATCGTGGTCAAATGGGTCGACTACACGAAC
AAGTTCGGGCTCGGCTACATCCTCAACGACGGCAGCGTGGGCTGCATCCTGCGCGACGTGCCGACCACCGAGGGC
AGCAGGTCGGTCGTGCTCCCCCCCGCCGGCGTCTTCATCCGCGGCGCCGAGAGGCACATCCTCCGGCGCCAGGAC
GAGTCGTACGACGACAGGAGCCAGCCGATCCCCATGACGGAACCGATCAGGTTCTTCGAGAACAACGGCGAGAGC
GGGCTGTCGGAGGTGTCGGTCTCGCCCGAGCAGTTCCGGGTGGCCGTCGCCCCGGACGGCACGGCGGGCAAGATG
AATCCCGGGAGGGACATCTTCCAGCACCGGAAGCGGGAGAGGATCATCCTGTGGAAGAAGTTCGCCAACTACATG
ATTGCCTACGGCAGAGACGAAGCCGTCCCGGTCGAGGAGACGGAGGCGGCGGGCGTCTTGTCCCCGGGCGGCAAG
GGCGCGATGGCGGAGCTGGTGACGTTCTACCAGCGCTTCGGGGACGTCGGATGCTGGGTCTTTTGCGACGGCCAC
CTCCAGTTCAACTTCCCCGACCACACCAAGATCGTGCTGGACGCGACGGGCACCTGGTGCCACTTCTGGCACCTG
CCGCAGGAGGCGGCGCAGCTGCTGGCGGCGACGGGCACCATCGGGGCGGCGGCGCTGGACGAGCGGGCGACGCTG
TCGTACCCGCTGCAGACGCTGCTCAACTTCCAGGCCAAGCCGTCGGCGTCGCGGTCGGCGCGGGCGTCGACGTCG
CGGCGGCGGCCCGAGATCGAGCCGGCACTGCAGGGCATCCCGGCCGCCAACGACTTCCGGCGCAAGGTCGACTTC
ATCAAGAACGTGGTCAAGGAGTGGGTGGCCAACGGCGGGCTGGGCAACAGCGCCATGGGCCGCGACACGCGCCTG
CGCTGGACGGGCTTCCGCGAGACGGGGGCCGGGGCCGGGGCCGGGGCCGGGGCGGCGCCGGCGCCGCAGAAGCAC
GTGTGGGTCACCATCGGCGCCCGCTGGGGGGACAGCCGGCTGTCGGCGTACGTGGACCCGCGCCGGCCGTGGGAG
CTGCTGGGCGACGACGTCGTCGGCGGCTCGGGGAGCTGA
Gene >Hirsu2|9241
ATGGCTCATAGGTTGGCCGCTGCCCGTGGCGGCATCGACATGGATGCTTTGTCCCCTAGGGATGCAAATGCCCAG
CGAGCCCCCCGACCGGCCGAGATCAAGACCAAGACGGCGGCGCAGCTGAGAGCGGCGAAGGATAAGGAGCATCCT
CCGGCGCCCCCCGCGCAAGTCGCCGAGCCCCGGAGCTCCGATCGGCCAGATGGTGCCGTATATCAGGTCGGCAAG
CTGCTGGGCAAGGGGGGCTTTGCCATCTGCTACAGCGCCCATCTACTCCCGACGAAGCAGAGGTTCGCCCTGAAG
ATCGTCAAGAGCCGCATGCCGCCCAAGATGGAGCAGAAGGTGAGCTGCCGCCCGCCGTCTTCTCTCGCCCCCGCA
ACGAGGCCGGCTAACACGGGCGGTCCAGTTCCAGACAGAGCTGCAGATACACTCCAAGATGCGGCACAAAAACGT
TGTCCAGTTCTTCAGGGCCTTCTCCTTCGAGAGCTGCACCTTTCTCGTCCTCGAGCTCTGCAACAACGGCTCGCT
GATGGACATGGTGAAGCGACGGAAAGGCCTGACGGAGCCCGAGGTTCGCTTCTACTCGATCCAGATTGCCGGCGC
CATCAAGTATATGCACGGCAAGGGCATCATCCACCGCGACCTTAAGATGGGCAACATCTTCCTCGACGCTCAGAT
GAACGCAAAGATCGGCGACTTTGGGCTCGCCGCCTTGCTGGTCACTGGTAGGGACATGCAGACGATCCGGCGCAC
GACGCTGTGCGGCACCCCGAACTACATCGCCCCGGAGATCCTGGAGAAGGGCAAGAAGGGCCACGACCACATGGT
GGACATTTGGAGCCTGGGCATCATCATGTGAGTCTGTTGCTCCAGCCGTCCGACCCGAGTCGTCCGTCGACGCCA
CGCCGGCGCCGGCCTGCTAACCCTCGGCAGGTTTGCCATGGTGACGTCCAAGCCGCCCTTTCAGTCCTCGACGAC
GGACGAGATCTACCGCCGCGCCCGCGAACGAGACTACGAATGGCCGACGGCCGACGCTTCGCAAAAGTACATCAG
CCAGGAGGCCAAGGACCTGGTCGCGACGATGCTCGAGGACGCAGACAGGCGTCCGGACCCGGAACTCATCGTCCA
GCACGCCTTCTTCCAGTCGGGCTACATGCCGACCCAGGCCGACATGAGCCCTCGCTTGCGCGAGCTGCCCCCGGA
GCGCCAGGAGTTCTACGGCTCGCGCATGAGCCCCTCGCTGCAGGCGCAGTCGCACCGAAACCTGAAGCAGATGTG
CCAGGAGTGCGGCGTGGGGCCCCTGAGCCAGGAGAACTTCATCCCGACGCCGATCTGGAAAGAGATGGCGGCCGA
GGAGAAGGCAGGGCTGACGCCGGCCATACCGCTGGCCGAGAACTTGGTCTACCGGCCCTTCGAGGCCTTCCTCAA
GGACCAGAAGCAGCAGCTCCGCACCAAGTACGCCTCTTCCATCGTCTCGCATCCAGCGCCGCCGGCCGCCTCGGC
AGAGGATCCGCTGGCAGCCGCACCCAAGGCACCCGTCGGCCTGCTGCGACAGCCGCCACAGAGCTTTGCCGCCCA
GCAGCGAGCGCAGAACCGGCCGTCGGCGGCCCCGTCCAAGGCGAAGCCGCAGCCTCGGCCCTTGACGGAGCCCGC
CGCGCCCCCGCCTCCCGCCGCGCAGCCGATGCGGGCGCGGTCCCGGCCGGAGGCCCACCCCGAGCCGGCCGTCAA
GGAGGCAGCGCCGGAGCGTACGCGAACCATGAAGAGCATGCGCAGCTCGGTGCGCCCCGTCCTGCCAACGACGAG
GTCAGCCCCCAGCTTGCAGGTCGCCGAGCGGGCGGCGGCGATTTCTTCGGAGCCGCCGGCACCCCTCAAGAGACA
CAGCTCGGACTCGATGCAGCCGGCGACGCTCTTCGGCCCGGAGGAGAGGCCCGTGGACATCGCGGGAAGCAAGCC
CGACGTGATCCTGGAGCGCCTGAGGCGTCTGCAGACGGAACTCGAACGGGCGCTCAACTCGCGCACCATGGCCAT
CATTTCTTCCAAGACGGTGACGCCGCCGCACCCGCACATCGTGGTCAAATGGGTCGACTACACGAACAAGTTCGG
GCTCGGCTACATCCTCAACGACGGCAGCGTGGGCTGCATCCTGCGCGACGTGCCGACCACCGAGGGCAGCAGGTC
GGTCGTGCTCCCCCCCGCCGGCGTCTTCATCCGCGGCGCCGAGAGGCACATCCTCCGGCGCCAGGACGAGTCGTA
CGACGACAGGAGCCAGCCGATCCCCATGACGGAACCGATCAGGTTCTTCGAGAACAACGGCGAGAGCGGGCTGTC
GGAGGTGTCGGTCTCGCCCGAGCAGTTCCGGGTGGCCGTCGCCCCGGACGGCACGGCGGGCAAGATGAATCCCGG
GAGGGACATCTTCCAGCACCGGAAGCGGGAGAGGATCATCCTGTGGAAGAAGTTCGCCAACTACATGATTGCCTA
CGGCAGAGACGAAGCCGTCCCGGTCGAGGAGACGGAGGCGGCGGGCGTCTTGTCCCCGGGCGGCAAGGGCGCGAT
GGCGGAGCTGGTGACGTTCTACCAGCGCTTCGGGGACGTCGGATGCTGGGTCTTTTGCGACGGCCACCTCCAGGT
AGGTCTCCATCCCCCACCCCGGGCGCGGAGGAGGAGGGAGGCGGAGGAAGCGACACTGACGGCCGGCCGGCTTGG
CACAGTTCAACTTCCCCGACCACACCAAGATCGTGCTGGACGCGACGGGCACCTGGTGCCACTTCTGGCACCTGC
CGCAGGAGGCGGCGCAGCTGCTGGCGGCGACGGGCACCATCGGGGCGGCGGCGCTGGACGAGCGGGCGACGCTGT
CGTACCCGCTGCAGACGCTGCTCAACTTCCAGGCCAAGCCGTCGGCGTCGCGGTCGGCGCGGGCGTCGACGTCGC
GGCGGCGGCCCGAGATCGAGCCGGCACTGCAGGGCATCCCGGCCGCCAACGACTTCCGGCGCAAGGTCGACTTCA
TCAAGAACGTGGTCAAGGAGTGGGTGGCCAACGGCGGGCTGGGCAACAGCGCCATGGGCCGCGACACGCGCCTGC
GCTGGACGGGCTTCCGCGAGACGGGGGCCGGGGCCGGGGCCGGGGCCGGGGCGGCGCCGGCGCCGCAGAAGCACG
TGTGGGTCACCATCGGCGCCCGCTGGGGGGACAGCCGGCTGTCGGCGTACGTGGACCCGCGCCGGCCGTGGGAGC
TGCTGGGCGACGACGTCGTCGGCGGCTCGGGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail