Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9232
Gene name
LocationContig_659:9574..10279
Strand-
Gene length (bp)705
Transcript length (bp)423
Coding sequence length (bp)423
Protein length (aa) 141

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-11 73 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11943|ACPM_NEUCR Acyl carrier protein, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-12 PE=1 SV=2 1 139 4.0E-50
sp|Q10217|ACPM_SCHPO Putative acyl carrier protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.09 PE=3 SV=1 27 139 1.0E-31
sp|O80800|ACPM2_ARATH Acyl carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MTACP2 PE=1 SV=1 55 139 3.0E-26
sp|P53665|ACPM1_ARATH Acyl carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MTACP1 PE=2 SV=1 42 137 5.0E-25
sp|P32463|ACPM_YEAST Acyl carrier protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACP1 PE=1 SV=1 23 139 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11943|ACPM_NEUCR Acyl carrier protein, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-12 PE=1 SV=2 1 139 4.0E-50
sp|Q10217|ACPM_SCHPO Putative acyl carrier protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.09 PE=3 SV=1 27 139 1.0E-31
sp|O80800|ACPM2_ARATH Acyl carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MTACP2 PE=1 SV=1 55 139 3.0E-26
sp|P53665|ACPM1_ARATH Acyl carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MTACP1 PE=2 SV=1 42 137 5.0E-25
sp|P32463|ACPM_YEAST Acyl carrier protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACP1 PE=1 SV=1 23 139 2.0E-22
sp|P52505|ACPM_BOVIN Acyl carrier protein, mitochondrial OS=Bos taurus GN=NDUFAB1 PE=1 SV=2 16 138 3.0E-19
sp|Q0MQC3|ACPM_PANTR Acyl carrier protein, mitochondrial OS=Pan troglodytes GN=NDUFAB1 PE=2 SV=1 9 138 4.0E-19
sp|O14561|ACPM_HUMAN Acyl carrier protein, mitochondrial OS=Homo sapiens GN=NDUFAB1 PE=1 SV=3 9 138 4.0E-19
sp|Q0MQC2|ACPM_GORGO Acyl carrier protein, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFAB1 PE=2 SV=1 9 138 4.0E-19
sp|Q0MQC1|ACPM_PONPY Acyl carrier protein, mitochondrial OS=Pongo pygmaeus GN=NDUFAB1 PE=2 SV=1 9 138 5.0E-19
sp|Q9CR21|ACPM_MOUSE Acyl carrier protein, mitochondrial OS=Mus musculus GN=Ndufab1 PE=1 SV=1 49 138 2.0E-18
sp|Q94519|ACPM_DROME Acyl carrier protein, mitochondrial OS=Drosophila melanogaster GN=ND-ACP PE=2 SV=1 49 138 3.0E-18
sp|P58553|ACP_NOSS1 Acyl carrier protein OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=acpP PE=3 SV=2 77 136 1.0E-17
sp|P20804|ACP_SYNY3 Acyl carrier protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acpP PE=1 SV=2 79 133 1.0E-16
sp|Q54E22|ACPM_DICDI Acyl carrier protein, mitochondrial OS=Dictyostelium discoideum GN=ndufab1 PE=3 SV=1 17 139 2.0E-16
sp|Q119B3|ACP_TRIEI Acyl carrier protein OS=Trichodesmium erythraeum (strain IMS101) GN=acpP PE=3 SV=1 79 138 3.0E-16
sp|P43709|ACP_HAEIN Acyl carrier protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=acpP PE=3 SV=1 81 135 4.0E-16
sp|A5UFV8|ACP_HAEIG Acyl carrier protein OS=Haemophilus influenzae (strain PittGG) GN=acpP PE=3 SV=1 81 135 4.0E-16
sp|A5UAZ7|ACP_HAEIE Acyl carrier protein OS=Haemophilus influenzae (strain PittEE) GN=acpP PE=3 SV=1 81 135 4.0E-16
sp|Q4QP33|ACP_HAEI8 Acyl carrier protein OS=Haemophilus influenzae (strain 86-028NP) GN=acpP PE=3 SV=1 81 135 4.0E-16
sp|Q9FGJ4|ACPM3_ARATH Acyl carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=MTACP2 PE=2 SV=1 55 136 1.0E-15
sp|B1WRM4|ACP_CYAA5 Acyl carrier protein OS=Cyanothece sp. (strain ATCC 51142) GN=acpP PE=3 SV=1 79 133 1.0E-15
sp|Q8KAN9|ACP_CHLTE Acyl carrier protein OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acpP PE=3 SV=1 81 136 2.0E-15
sp|B7KL68|ACP_CYAP7 Acyl carrier protein OS=Cyanothece sp. (strain PCC 7424) GN=acpP PE=3 SV=1 74 140 2.0E-15
sp|Q7VKH6|ACP_HAEDU Acyl carrier protein OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=acpP PE=3 SV=1 81 133 2.0E-15
sp|B3GZ71|ACP_ACTP7 Acyl carrier protein OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=acpP PE=3 SV=1 81 133 2.0E-15
sp|A3N3B5|ACP_ACTP2 Acyl carrier protein OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=acpP PE=3 SV=1 81 133 2.0E-15
sp|B8F7C3|ACP_HAEPS Acyl carrier protein OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=acpP PE=3 SV=1 81 135 3.0E-15
sp|Q9CJS5|ACP_PASMU Acyl carrier protein OS=Pasteurella multocida (strain Pm70) GN=acpP PE=3 SV=1 83 135 3.0E-15
sp|B0UUZ3|ACP_HISS2 Acyl carrier protein OS=Histophilus somni (strain 2336) GN=acpP PE=3 SV=1 81 135 3.0E-15
sp|Q0I0V3|ACP_HAES1 Acyl carrier protein OS=Haemophilus somnus (strain 129Pt) GN=acpP PE=3 SV=1 81 135 3.0E-15
sp|Q0VQN0|ACP_ALCBS Acyl carrier protein OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acpP PE=3 SV=1 80 133 3.0E-15
sp|B4S3N7|ACP_PROA2 Acyl carrier protein OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=acpP PE=3 SV=1 58 135 7.0E-15
sp|B0SM36|ACP_LEPBP Acyl carrier protein OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acpP PE=3 SV=1 79 133 1.0E-14
sp|B0SDK7|ACP_LEPBA Acyl carrier protein OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acpP PE=3 SV=1 79 133 1.0E-14
sp|Q5P0D3|ACP_AROAE Acyl carrier protein OS=Aromatoleum aromaticum (strain EbN1) GN=acpP PE=3 SV=1 61 133 1.0E-14
sp|B3QRN4|ACP_CHLP8 Acyl carrier protein OS=Chlorobaculum parvum (strain NCIB 8327) GN=acpP PE=3 SV=1 81 136 1.0E-14
sp|Q65RC8|ACP_MANSM Acyl carrier protein OS=Mannheimia succiniciproducens (strain MBEL55E) GN=acpP PE=3 SV=1 81 135 2.0E-14
sp|Q8R9W1|ACP_CALS4 Acyl carrier protein OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=acpP PE=3 SV=2 79 135 2.0E-14
sp|Q2JQZ8|ACP_SYNJA Acyl carrier protein OS=Synechococcus sp. (strain JA-3-3Ab) GN=acpP PE=3 SV=1 81 136 2.0E-14
sp|Q8EDH4|ACP_SHEON Acyl carrier protein OS=Shewanella oneidensis (strain MR-1) GN=acpP PE=3 SV=1 81 133 2.0E-14
sp|B0K1W0|ACP_THEPX Acyl carrier protein OS=Thermoanaerobacter sp. (strain X514) GN=acpP PE=3 SV=1 79 135 2.0E-14
sp|B0K9X7|ACP_THEP3 Acyl carrier protein OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=acpP PE=3 SV=1 79 135 2.0E-14
sp|A1STW4|ACP_PSYIN Acyl carrier protein OS=Psychromonas ingrahamii (strain 37) GN=acpP PE=3 SV=1 81 135 2.0E-14
sp|P20803|ACP_ANAVA Acyl carrier protein (Fragment) OS=Anabaena variabilis GN=acpP PE=1 SV=2 77 133 2.0E-14
sp|Q3B0I3|ACP_SYNS9 Acyl carrier protein OS=Synechococcus sp. (strain CC9902) GN=acpP PE=3 SV=1 79 133 2.0E-14
sp|A1K5Y8|ACP_AZOSB Acyl carrier protein OS=Azoarcus sp. (strain BH72) GN=acpP PE=3 SV=1 61 133 2.0E-14
sp|Q7U9V9|ACP_SYNPX Acyl carrier protein OS=Synechococcus sp. (strain WH8102) GN=acpP PE=3 SV=1 79 133 3.0E-14
sp|A5GI58|ACP_SYNPW Acyl carrier protein OS=Synechococcus sp. (strain WH7803) GN=acpP PE=3 SV=1 79 133 3.0E-14
sp|C0QUD3|ACP_PERMH Acyl carrier protein OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=acpP PE=3 SV=1 79 133 3.0E-14
sp|Q85FZ0|ACP_CYAME Acyl carrier protein OS=Cyanidioschyzon merolae GN=acpP PE=3 SV=1 83 134 3.0E-14
sp|A6VQU9|ACP_ACTSZ Acyl carrier protein OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=acpP PE=3 SV=1 81 135 3.0E-14
sp|A1BJA4|ACP_CHLPD Acyl carrier protein OS=Chlorobium phaeobacteroides (strain DSM 266) GN=acpP PE=3 SV=1 60 136 3.0E-14
sp|A5GQ76|ACP_SYNR3 Acyl carrier protein OS=Synechococcus sp. (strain RCC307) GN=acpP PE=3 SV=1 79 133 3.0E-14
sp|Q8EXX4|ACP_LEPIN Acyl carrier protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acpP PE=3 SV=1 79 135 4.0E-14
sp|Q75FW6|ACP_LEPIC Acyl carrier protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acpP PE=3 SV=1 79 135 4.0E-14
sp|Q053L5|ACP_LEPBL Acyl carrier protein OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=acpP PE=3 SV=1 79 135 4.0E-14
sp|Q04R63|ACP_LEPBJ Acyl carrier protein OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=acpP PE=3 SV=1 79 135 4.0E-14
sp|B3EED1|ACP_CHLL2 Acyl carrier protein OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=acpP PE=3 SV=1 81 136 4.0E-14
sp|Q7V9R0|ACP_PROMA Acyl carrier protein OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=acpP PE=3 SV=1 83 133 5.0E-14
sp|P29189|ACP_GUITH Acyl carrier protein OS=Guillardia theta GN=acpP PE=3 SV=1 58 133 5.0E-14
sp|C1DCE5|ACP_LARHH Acyl carrier protein OS=Laribacter hongkongensis (strain HLHK9) GN=acpP PE=3 SV=1 61 133 5.0E-14
sp|B1H0Q2|ACP_UNCTG Acyl carrier protein OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=acpP PE=3 SV=1 79 133 6.0E-14
sp|Q7V4J6|ACP_PROMM Acyl carrier protein OS=Prochlorococcus marinus (strain MIT 9313) GN=acpP PE=3 SV=1 82 133 6.0E-14
sp|Q1IHZ5|ACP_KORVE Acyl carrier protein OS=Koribacter versatilis (strain Ellin345) GN=acpP PE=3 SV=1 79 133 6.0E-14
sp|B9L7V8|ACP_NAUPA Acyl carrier protein OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=acpP PE=3 SV=1 80 133 6.0E-14
sp|Q3B6L1|ACP_CHLL7 Acyl carrier protein OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=acpP PE=3 SV=1 81 136 7.0E-14
sp|Q46IK3|ACP_PROMT Acyl carrier protein OS=Prochlorococcus marinus (strain NATL2A) GN=acpP PE=3 SV=1 83 133 7.0E-14
sp|A2C556|ACP_PROM1 Acyl carrier protein OS=Prochlorococcus marinus (strain NATL1A) GN=acpP PE=3 SV=1 83 133 7.0E-14
sp|A4SCL1|ACP_CHLPM Acyl carrier protein OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=acpP PE=3 SV=1 81 136 7.0E-14
sp|Q2SXU4|ACP_BURTA Acyl carrier protein OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|Q63S86|ACP_BURPS Acyl carrier protein OS=Burkholderia pseudomallei (strain K96243) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|A3NBT9|ACP_BURP6 Acyl carrier protein OS=Burkholderia pseudomallei (strain 668) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|Q3JQ68|ACP_BURP1 Acyl carrier protein OS=Burkholderia pseudomallei (strain 1710b) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|A3NXM6|ACP_BURP0 Acyl carrier protein OS=Burkholderia pseudomallei (strain 1106a) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|A1V6C7|ACP_BURMS Acyl carrier protein OS=Burkholderia mallei (strain SAVP1) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|Q62LT9|ACP_BURMA Acyl carrier protein OS=Burkholderia mallei (strain ATCC 23344) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|A2S9Y5|ACP_BURM9 Acyl carrier protein OS=Burkholderia mallei (strain NCTC 10229) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|A3MM52|ACP_BURM7 Acyl carrier protein OS=Burkholderia mallei (strain NCTC 10247) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|A9ADE8|ACP_BURM1 Acyl carrier protein OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|Q39I83|ACP_BURL3 Acyl carrier protein OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|A0K5U9|ACP_BURCH Acyl carrier protein OS=Burkholderia cenocepacia (strain HI2424) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|B1JYA3|ACP_BURCC Acyl carrier protein OS=Burkholderia cenocepacia (strain MC0-3) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|Q1BXV1|ACP_BURCA Acyl carrier protein OS=Burkholderia cenocepacia (strain AU 1054) GN=acpP PE=3 SV=1 83 132 7.0E-14
sp|Q47EG8|ACP_DECAR Acyl carrier protein OS=Dechloromonas aromatica (strain RCB) GN=acpP PE=3 SV=1 82 134 9.0E-14
sp|Q15TZ9|ACP_PSEA6 Acyl carrier protein OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=acpP PE=3 SV=1 81 139 1.0E-13
sp|Q8DHS3|ACP_THEEB Acyl carrier protein OS=Thermosynechococcus elongatus (strain BP-1) GN=acpP PE=3 SV=1 79 136 1.0E-13
sp|B4SBB2|ACP_PELPB Acyl carrier protein OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=acpP PE=3 SV=1 81 137 1.0E-13
sp|B3E2J4|ACP_GEOLS Acyl carrier protein OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=acpP PE=3 SV=1 86 133 1.0E-13
sp|C4L8E4|ACP_TOLAT Acyl carrier protein OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=acpP PE=3 SV=1 81 138 1.0E-13
sp|Q8RGX5|ACP_FUSNN Acyl carrier protein OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=acpP PE=3 SV=1 79 133 1.0E-13
sp|O67611|ACP_AQUAE Acyl carrier protein OS=Aquifex aeolicus (strain VF5) GN=acpP PE=1 SV=1 79 133 1.0E-13
sp|Q8Y0J1|ACP1_RALSO Acyl carrier protein 1 OS=Ralstonia solanacearum (strain GMI1000) GN=acpP1 PE=3 SV=1 82 132 2.0E-13
sp|Q606L6|ACP_METCA Acyl carrier protein OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|Q0A8R8|ACP_ALKEH Acyl carrier protein OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|B2V6T8|ACP_SULSY Acyl carrier protein OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|Q39V90|ACP_GEOMG Acyl carrier protein OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=acpP PE=3 SV=1 79 133 2.0E-13
sp|P63447|ACP_XANCP Acyl carrier protein OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acpP PE=3 SV=2 81 133 2.0E-13
sp|B0RYI4|ACP_XANCB Acyl carrier protein OS=Xanthomonas campestris pv. campestris (strain B100) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|Q4URQ3|ACP_XANC8 Acyl carrier protein OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|Q3BWI5|ACP_XANC5 Acyl carrier protein OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|P63446|ACP_XANAC Acyl carrier protein OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acpP PE=3 SV=2 81 133 2.0E-13
sp|B9M0W2|ACP_GEODF Acyl carrier protein OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=acpP PE=3 SV=1 79 137 2.0E-13
sp|B2SNN4|ACP_XANOP Acyl carrier protein OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|Q2P7B5|ACP_XANOM Acyl carrier protein OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|Q1XDK6|ACP_PYRYE Acyl carrier protein OS=Pyropia yezoensis GN=acpP PE=3 SV=1 86 133 2.0E-13
sp|B3PEV2|ACP_CELJU Acyl carrier protein OS=Cellvibrio japonicus (strain Ueda107) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|A1WWE5|ACP_HALHL Acyl carrier protein OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|A5GF63|ACP_GEOUR Acyl carrier protein OS=Geobacter uraniireducens (strain Rf4) GN=acpP PE=3 SV=1 79 137 2.0E-13
sp|B3R210|ACP_CUPTR Acyl carrier protein OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acpP PE=3 SV=1 82 132 2.0E-13
sp|Q46Z08|ACP_CUPPJ Acyl carrier protein OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acpP PE=3 SV=1 82 132 2.0E-13
sp|Q0K8M2|ACP_CUPNH Acyl carrier protein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acpP PE=3 SV=1 82 132 2.0E-13
sp|Q1LKM2|ACP_CUPMC Acyl carrier protein OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acpP PE=3 SV=1 82 132 2.0E-13
sp|Q5N3E5|ACP_SYNP6 Acyl carrier protein OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=acpP PE=3 SV=1 79 133 2.0E-13
sp|Q31QV1|ACP_SYNE7 Acyl carrier protein OS=Synechococcus elongatus (strain PCC 7942) GN=acpP PE=3 SV=1 79 133 2.0E-13
sp|Q12LV4|ACP_SHEDO Acyl carrier protein OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acpP PE=3 SV=1 81 133 2.0E-13
sp|B1LTE7|ACP_METRJ Acyl carrier protein OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acpP PE=3 SV=1 79 133 2.0E-13
sp|Q7MLZ9|ACP_VIBVY Acyl carrier protein OS=Vibrio vulnificus (strain YJ016) GN=acpP PE=3 SV=1 79 133 3.0E-13
sp|Q8D8G9|ACP_VIBVU Acyl carrier protein OS=Vibrio vulnificus (strain CMCP6) GN=acpP PE=3 SV=3 79 133 3.0E-13
sp|B4RAG3|ACP_PHEZH Acyl carrier protein OS=Phenylobacterium zucineum (strain HLK1) GN=acpP PE=3 SV=1 79 133 3.0E-13
sp|Q21K87|ACP_SACD2 Acyl carrier protein OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=acpP PE=3 SV=1 81 133 3.0E-13
sp|C6E345|ACP_GEOSM Acyl carrier protein OS=Geobacter sp. (strain M21) GN=acpP PE=3 SV=1 79 137 4.0E-13
sp|B5E8U3|ACP_GEOBB Acyl carrier protein OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=acpP PE=3 SV=1 79 137 4.0E-13
sp|O19921|ACP_CYACA Acyl carrier protein OS=Cyanidium caldarium GN=acpP PE=3 SV=1 60 136 4.0E-13
sp|B4ETD0|ACP_PROMH Acyl carrier protein OS=Proteus mirabilis (strain HI4320) GN=acpP PE=3 SV=1 81 135 4.0E-13
sp|Q9EZI1|ACP_XANAL Acyl carrier protein OS=Xanthomonas albilineans GN=acpP PE=3 SV=3 81 133 4.0E-13
sp|Q11HG4|ACP_CHESB Acyl carrier protein OS=Chelativorans sp. (strain BNC1) GN=acpP PE=3 SV=1 79 133 4.0E-13
sp|Q9A7P3|ACP_CAUCR Acyl carrier protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acpP PE=3 SV=1 79 136 4.0E-13
sp|B8GVP4|ACP_CAUCN Acyl carrier protein OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=acpP PE=3 SV=1 79 136 4.0E-13
sp|B1I2D2|ACP_DESAP Acyl carrier protein OS=Desulforudis audaxviator (strain MP104C) GN=acpP PE=3 SV=1 79 133 4.0E-13
sp|B8D9D7|ACP_BUCA5 Acyl carrier protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=acpP PE=3 SV=1 63 136 4.0E-13
sp|A1B2X1|ACP_PARDP Acyl carrier protein OS=Paracoccus denitrificans (strain Pd 1222) GN=acpP PE=3 SV=1 79 133 5.0E-13
sp|A8EWF1|ACP_ARCB4 Acyl carrier protein OS=Arcobacter butzleri (strain RM4018) GN=acpP PE=3 SV=1 79 136 5.0E-13
sp|Q1H165|ACP_METFK Acyl carrier protein OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acpP PE=3 SV=1 82 133 5.0E-13
sp|Q984T3|ACP_RHILO Acyl carrier protein AcpP OS=Rhizobium loti (strain MAFF303099) GN=acpP PE=3 SV=1 79 133 5.0E-13
sp|P0A2W2|ACP_VIBPA Acyl carrier protein OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acpP PE=3 SV=2 79 133 5.0E-13
sp|P0A2W3|ACP_VIBHA Acyl carrier protein OS=Vibrio harveyi GN=acpP PE=1 SV=2 79 133 5.0E-13
sp|A7MZU3|ACP_VIBCB Acyl carrier protein OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=acpP PE=3 SV=1 79 133 5.0E-13
sp|Q1ICY6|ACP_PSEE4 Acyl carrier protein OS=Pseudomonas entomophila (strain L48) GN=acpP PE=3 SV=1 81 133 5.0E-13
sp|Q1QX53|ACP_CHRSD Acyl carrier protein OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=acpP PE=3 SV=1 81 134 6.0E-13
sp|A9III0|ACP_BORPD Acyl carrier protein OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=acpP PE=3 SV=1 61 133 6.0E-13
sp|Q7W5I7|ACP_BORPA Acyl carrier protein OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=acpP PE=3 SV=2 61 133 6.0E-13
sp|A9BD51|ACP_PROM4 Acyl carrier protein OS=Prochlorococcus marinus (strain MIT 9211) GN=acpP PE=3 SV=1 79 133 6.0E-13
sp|B8GSL1|ACP_THISH Acyl carrier protein OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=acpP PE=3 SV=1 81 133 7.0E-13
sp|C3M9B6|ACP_RHISN Acyl carrier protein OS=Rhizobium sp. (strain NGR234) GN=acpP PE=3 SV=1 79 133 8.0E-13
sp|P19372|ACP_RHIME Acyl carrier protein AcpP OS=Rhizobium meliloti (strain 1021) GN=acpP PE=1 SV=2 79 133 8.0E-13
sp|B1ZK55|ACP_METPB Acyl carrier protein OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acpP PE=3 SV=1 79 133 8.0E-13
sp|A9W067|ACP_METEP Acyl carrier protein OS=Methylobacterium extorquens (strain PA1) GN=acpP PE=3 SV=1 79 133 8.0E-13
sp|B7L0F0|ACP_METC4 Acyl carrier protein OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acpP PE=3 SV=1 79 133 8.0E-13
sp|Q2SK49|ACP_HAHCH Acyl carrier protein OS=Hahella chejuensis (strain KCTC 2396) GN=acpP PE=3 SV=1 82 136 8.0E-13
sp|Q5SL79|ACP_THET8 Acyl carrier protein OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acpP PE=1 SV=1 75 133 9.0E-13
sp|Q72LL3|ACP_THET2 Acyl carrier protein OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=acpP PE=3 SV=1 75 133 9.0E-13
sp|Q7VW32|ACP_BORPE Acyl carrier protein OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=acpP PE=3 SV=1 61 133 1.0E-12
sp|Q7WD23|ACP_BORBR Acyl carrier protein OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=acpP PE=3 SV=1 61 133 1.0E-12
sp|Q2KW22|ACP_BORA1 Acyl carrier protein OS=Bordetella avium (strain 197N) GN=acpP PE=3 SV=1 61 133 1.0E-12
sp|P51280|ACP_PORPU Acyl carrier protein OS=Porphyra purpurea GN=acpP PE=3 SV=1 86 133 1.0E-12
sp|Q74CR8|ACP_GEOSL Acyl carrier protein OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=acpP PE=3 SV=1 79 133 1.0E-12
sp|O54439|ACP1_PSEAE Acyl carrier protein 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acpP1 PE=3 SV=4 81 134 1.0E-12
sp|P80922|ACP_OCELI Acyl carrier protein OS=Oceanospirillum linum GN=acpP PE=1 SV=2 81 135 1.0E-12
sp|Q7M9W1|ACP_WOLSU Acyl carrier protein OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=acpP PE=3 SV=1 79 133 1.0E-12
sp|A4VMS0|ACP_PSEU5 Acyl carrier protein OS=Pseudomonas stutzeri (strain A1501) GN=acpP PE=3 SV=1 81 133 1.0E-12
sp|C1DRH0|ACP_AZOVD Acyl carrier protein OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=acpP PE=3 SV=1 81 133 1.0E-12
sp|B1XTK9|ACP_POLNS Acyl carrier protein OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=acpP PE=3 SV=1 82 132 1.0E-12
sp|A1US60|ACP_BARBK Acyl carrier protein OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acpP PE=3 SV=1 79 133 1.0E-12
sp|Q6MLJ8|ACP_BDEBA Acyl carrier protein OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acpP PE=3 SV=1 79 133 1.0E-12
sp|Q9RA32|ACP_MORMI Acyl carrier protein OS=Moritella marina GN=acpP PE=3 SV=3 81 135 2.0E-12
sp|B8D7N9|ACP_BUCAT Acyl carrier protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=acpP PE=3 SV=1 63 133 2.0E-12
sp|P57433|ACP_BUCAI Acyl carrier protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=acpP PE=3 SV=1 63 133 2.0E-12
sp|Q9KQH8|ACP_VIBCH Acyl carrier protein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acpP PE=3 SV=3 79 133 2.0E-12
sp|A4XSS7|ACP_PSEMY Acyl carrier protein OS=Pseudomonas mendocina (strain ymp) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B8DJF9|ACP_DESVM Acyl carrier protein OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=acpP PE=3 SV=1 81 136 2.0E-12
sp|B9KQD1|ACP_RHOSK Acyl carrier protein OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=acpP PE=3 SV=1 79 133 2.0E-12
sp|A4WRF7|ACP_RHOS5 Acyl carrier protein OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=acpP PE=3 SV=1 79 133 2.0E-12
sp|Q3J3L2|ACP_RHOS4 Acyl carrier protein OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=acpP PE=3 SV=1 79 133 2.0E-12
sp|A3PIR9|ACP_RHOS1 Acyl carrier protein OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=acpP PE=3 SV=1 79 133 2.0E-12
sp|Q3Z323|ACP_SHISS Acyl carrier protein OS=Shigella sonnei (strain Ss046) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|Q0T5U2|ACP_SHIF8 Acyl carrier protein OS=Shigella flexneri serotype 5b (strain 8401) GN=acpP PE=1 SV=1 81 133 2.0E-12
sp|Q32EV4|ACP_SHIDS Acyl carrier protein OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|Q31ZE9|ACP_SHIBS Acyl carrier protein OS=Shigella boydii serotype 4 (strain Sb227) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B2U527|ACP_SHIB3 Acyl carrier protein OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|P0A6B1|ACP_SALTY Acyl carrier protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acpP PE=3 SV=2 81 133 2.0E-12
sp|P0A6B2|ACP_SALTI Acyl carrier protein OS=Salmonella typhi GN=acpP PE=3 SV=2 81 133 2.0E-12
sp|B4TTG0|ACP_SALSV Acyl carrier protein OS=Salmonella schwarzengrund (strain CVM19633) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B5BAH9|ACP_SALPK Acyl carrier protein OS=Salmonella paratyphi A (strain AKU_12601) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|C0Q798|ACP_SALPC Acyl carrier protein OS=Salmonella paratyphi C (strain RKS4594) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|A9N5L0|ACP_SALPB Acyl carrier protein OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|Q5PGU4|ACP_SALPA Acyl carrier protein OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B4T328|ACP_SALNS Acyl carrier protein OS=Salmonella newport (strain SL254) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B4TFH1|ACP_SALHS Acyl carrier protein OS=Salmonella heidelberg (strain SL476) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B5RBA6|ACP_SALG2 Acyl carrier protein OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B5QXE0|ACP_SALEP Acyl carrier protein OS=Salmonella enteritidis PT4 (strain P125109) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B5FKB1|ACP_SALDC Acyl carrier protein OS=Salmonella dublin (strain CT_02021853) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|Q57QG1|ACP_SALCH Acyl carrier protein OS=Salmonella choleraesuis (strain SC-B67) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B5F911|ACP_SALA4 Acyl carrier protein OS=Salmonella agona (strain SL483) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|A6T7F4|ACP_KLEP7 Acyl carrier protein OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B5XXH6|ACP_KLEP3 Acyl carrier protein OS=Klebsiella pneumoniae (strain 342) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|Q1RD62|ACP_ECOUT Acyl carrier protein OS=Escherichia coli (strain UTI89 / UPEC) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B1LI51|ACP_ECOSM Acyl carrier protein OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B6I9H1|ACP_ECOSE Acyl carrier protein OS=Escherichia coli (strain SE11) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|P0A6A8|ACP_ECOLI Acyl carrier protein OS=Escherichia coli (strain K12) GN=acpP PE=1 SV=2 81 133 2.0E-12
sp|B1IUH1|ACP_ECOLC Acyl carrier protein OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|P0A6A9|ACP_ECOL6 Acyl carrier protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acpP PE=3 SV=2 81 133 2.0E-12
sp|Q0TIY0|ACP_ECOL5 Acyl carrier protein OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|A7ZZ51|ACP_ECOHS Acyl carrier protein OS=Escherichia coli O9:H4 (strain HS) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B1XA04|ACP_ECODH Acyl carrier protein OS=Escherichia coli (strain K12 / DH10B) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|C4ZS34|ACP_ECOBW Acyl carrier protein OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B7LX28|ACP_ECO8A Acyl carrier protein OS=Escherichia coli O8 (strain IAI1) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B7MTM4|ACP_ECO81 Acyl carrier protein OS=Escherichia coli O81 (strain ED1a) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B7NKI6|ACP_ECO7I Acyl carrier protein OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|P0A6B0|ACP_ECO57 Acyl carrier protein OS=Escherichia coli O157:H7 GN=acpP PE=3 SV=2 81 133 2.0E-12
sp|B7LG27|ACP_ECO55 Acyl carrier protein OS=Escherichia coli (strain 55989 / EAEC) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B7MJ81|ACP_ECO45 Acyl carrier protein OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|B7UPB0|ACP_ECO27 Acyl carrier protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|A7ZKJ7|ACP_ECO24 Acyl carrier protein OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|A7MFR6|ACP_CROS8 Acyl carrier protein OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acpP PE=3 SV=1 81 133 2.0E-12
sp|P0A6B3|ACP1_SHIFL Acyl carrier protein OS=Shigella flexneri GN=acpP PE=3 SV=2 81 133 2.0E-12
sp|Q0BPZ5|ACP_GRABC Acyl carrier protein OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=acpP PE=3 SV=1 82 136 2.0E-12
sp|A8ZTV4|ACP_DESOH Acyl carrier protein OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=acpP PE=3 SV=1 79 133 2.0E-12
sp|B0CE03|ACP_ACAM1 Acyl carrier protein OS=Acaryochloris marina (strain MBIC 11017) GN=acpP PE=3 SV=1 79 133 2.0E-12
sp|Q9R6Z3|ACP_PHOPR Acyl carrier protein OS=Photobacterium profundum GN=acpP PE=3 SV=2 79 133 3.0E-12
sp|A1KRQ3|ACP_NEIMF Acyl carrier protein OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=acpP PE=3 SV=1 82 133 3.0E-12
sp|P63442|ACP_NEIMB Acyl carrier protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=acpP PE=3 SV=1 82 133 3.0E-12
sp|P63441|ACP_NEIMA Acyl carrier protein OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=acpP PE=3 SV=1 82 133 3.0E-12
sp|A9M3G2|ACP_NEIM0 Acyl carrier protein OS=Neisseria meningitidis serogroup C (strain 053442) GN=acpP PE=3 SV=1 82 133 3.0E-12
sp|A1VEK3|ACP_DESVV Acyl carrier protein OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=acpP PE=3 SV=1 81 136 3.0E-12
sp|Q72CS8|ACP_DESVH Acyl carrier protein OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=acpP PE=3 SV=1 81 136 3.0E-12
sp|A4G6S9|ACP_HERAR Acyl carrier protein OS=Herminiimonas arsenicoxydans GN=acpP PE=3 SV=1 82 132 3.0E-12
sp|B0UNZ6|ACP_METS4 Acyl carrier protein OS=Methylobacterium sp. (strain 4-46) GN=acpP PE=3 SV=1 81 133 3.0E-12
sp|B5EJD2|ACP_ACIF5 Acyl carrier protein OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=acpP PE=3 SV=1 77 133 3.0E-12
sp|B7JC10|ACP_ACIF2 Acyl carrier protein OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=acpP PE=3 SV=1 77 133 3.0E-12
sp|B4RR62|ACP_NEIG2 Acyl carrier protein OS=Neisseria gonorrhoeae (strain NCCP11945) GN=acpP PE=3 SV=1 82 133 3.0E-12
sp|Q5F604|ACP_NEIG1 Acyl carrier protein OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=acpP PE=3 SV=1 82 133 3.0E-12
sp|A2BYZ2|ACP_PROM5 Acyl carrier protein OS=Prochlorococcus marinus (strain MIT 9515) GN=acpP PE=3 SV=1 58 133 3.0E-12
sp|A6SXQ2|ACP_JANMA Acyl carrier protein OS=Janthinobacterium sp. (strain Marseille) GN=acpP PE=3 SV=1 82 132 3.0E-12
sp|Q7VI80|ACP_HELHP Acyl carrier protein OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|Q7UZQ0|ACP_PROMP Acyl carrier protein OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=acpP PE=3 SV=1 58 133 3.0E-12
sp|P63438|ACP_BRUSU Acyl carrier protein AcpP OS=Brucella suis biovar 1 (strain 1330) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|B0CKE3|ACP_BRUSI Acyl carrier protein OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|A5VP30|ACP_BRUO2 Acyl carrier protein OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|P63437|ACP_BRUME Acyl carrier protein AcpP OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|C0RHG7|ACP_BRUMB Acyl carrier protein OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|A9M8Y2|ACP_BRUC2 Acyl carrier protein OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|Q57EQ8|ACP_BRUAB Acyl carrier protein OS=Brucella abortus biovar 1 (strain 9-941) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|Q2YMG5|ACP_BRUA2 Acyl carrier protein OS=Brucella abortus (strain 2308) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|B2S9V7|ACP_BRUA1 Acyl carrier protein OS=Brucella abortus (strain S19) GN=acpP PE=3 SV=1 79 133 3.0E-12
sp|A8LQQ0|ACP_DINSH Acyl carrier protein OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=acpP PE=3 SV=1 87 133 4.0E-12
sp|C5CSE5|ACP_VARPS Acyl carrier protein OS=Variovorax paradoxus (strain S110) GN=acpP PE=3 SV=1 63 132 4.0E-12
sp|Q7VR21|ACP_BLOFL Acyl carrier protein OS=Blochmannia floridanus GN=acpP PE=3 SV=1 81 133 4.0E-12
sp|P80643|ACP_BACSU Acyl carrier protein OS=Bacillus subtilis (strain 168) GN=acpA PE=1 SV=1 79 137 4.0E-12
sp|A7Z4L2|ACP_BACMF Acyl carrier protein OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=acpP PE=3 SV=1 79 137 4.0E-12
sp|B2VDK4|ACP_ERWT9 Acyl carrier protein OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=acpP PE=3 SV=1 81 133 5.0E-12
sp|A2BTJ0|ACP_PROMS Acyl carrier protein OS=Prochlorococcus marinus (strain AS9601) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|A8G7B4|ACP_PROM2 Acyl carrier protein OS=Prochlorococcus marinus (strain MIT 9215) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|A3PF99|ACP_PROM0 Acyl carrier protein OS=Prochlorococcus marinus (strain MIT 9301) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|Q482J9|ACP_COLP3 Acyl carrier protein OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|B5ZWD3|ACP_RHILW Acyl carrier protein OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=acpP PE=3 SV=1 79 133 5.0E-12
sp|Q9RG22|ACP_RHILE Acyl carrier protein AcpP OS=Rhizobium leguminosarum GN=acpP PE=3 SV=3 79 133 5.0E-12
sp|Q1MJ06|ACP_RHIL3 Acyl carrier protein OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=acpP PE=3 SV=1 79 133 5.0E-12
sp|Q2KA89|ACP_RHIEC Acyl carrier protein OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=acpP PE=3 SV=1 79 133 5.0E-12
sp|B3PUU1|ACP_RHIE6 Acyl carrier protein OS=Rhizobium etli (strain CIAT 652) GN=acpP PE=3 SV=1 79 133 5.0E-12
sp|Q318D3|ACP_PROM9 Acyl carrier protein OS=Prochlorococcus marinus (strain MIT 9312) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|Q3K8L1|ACP_PSEPF Acyl carrier protein OS=Pseudomonas fluorescens (strain Pf0-1) GN=acpP PE=3 SV=1 81 133 5.0E-12
sp|C3K0N3|ACP_PSEFS Acyl carrier protein OS=Pseudomonas fluorescens (strain SBW25) GN=acpP PE=3 SV=1 81 133 5.0E-12
sp|P80923|ACP_PSESM Acyl carrier protein OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acpP PE=1 SV=3 81 133 5.0E-12
sp|B1JI34|ACP_YERPY Acyl carrier protein OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|Q669L4|ACP_YERPS Acyl carrier protein OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acpP PE=3 SV=3 83 133 5.0E-12
sp|A4TLS0|ACP_YERPP Acyl carrier protein OS=Yersinia pestis (strain Pestoides F) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|Q1CI22|ACP_YERPN Acyl carrier protein OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|A9R3P5|ACP_YERPG Acyl carrier protein OS=Yersinia pestis bv. Antiqua (strain Angola) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|Q8ZFT4|ACP_YERPE Acyl carrier protein OS=Yersinia pestis GN=acpP PE=3 SV=3 83 133 5.0E-12
sp|B2K755|ACP_YERPB Acyl carrier protein OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|Q1C6N1|ACP_YERPA Acyl carrier protein OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|A7FH28|ACP_YERP3 Acyl carrier protein OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acpP PE=3 SV=1 83 133 5.0E-12
sp|Q8D3A9|ACP_WIGBR Acyl carrier protein OS=Wigglesworthia glossinidia brevipalpis GN=acpP PE=3 SV=1 81 133 5.0E-12
sp|Q5FPB9|ACP_GLUOX Acyl carrier protein OS=Gluconobacter oxydans (strain 621H) GN=acpP PE=3 SV=1 79 136 5.0E-12
sp|Q1LT40|ACP_BAUCH Acyl carrier protein OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=acpP PE=3 SV=1 81 133 6.0E-12
sp|Q8UGE2|ACP_AGRFC Acyl carrier protein AcpP OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acpP PE=3 SV=3 79 133 6.0E-12
sp|Q2NU39|ACP_SODGM Acyl carrier protein OS=Sodalis glossinidius (strain morsitans) GN=acpP PE=3 SV=1 81 133 6.0E-12
sp|A9HRD8|ACP_GLUDA Acyl carrier protein OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=acpP PE=3 SV=1 82 136 6.0E-12
sp|Q07LE6|ACP_RHOP5 Acyl carrier protein OS=Rhodopseudomonas palustris (strain BisA53) GN=acpP PE=3 SV=1 79 133 6.0E-12
sp|Q88LL5|ACP_PSEPK Acyl carrier protein OS=Pseudomonas putida (strain KT2440) GN=acpP PE=3 SV=1 81 133 6.0E-12
sp|C5B8G9|ACP_EDWI9 Acyl carrier protein OS=Edwardsiella ictaluri (strain 93-146) GN=acpP PE=3 SV=1 87 133 7.0E-12
sp|Q3AQ12|ACP_CHLCH Acyl carrier protein OS=Chlorobium chlorochromatii (strain CaD3) GN=acpP PE=3 SV=1 80 136 7.0E-12
sp|B8ESH4|ACP_METSB Acyl carrier protein OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acpP PE=3 SV=1 79 133 7.0E-12
sp|Q1GHT1|ACP_RUEST Acyl carrier protein OS=Ruegeria sp. (strain TM1040) GN=acpP PE=3 SV=1 79 133 8.0E-12
sp|C6DKT2|ACP_PECCP Acyl carrier protein OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=acpP PE=3 SV=1 81 133 8.0E-12
sp|Q6D687|ACP_PECAS Acyl carrier protein OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=acpP PE=3 SV=3 81 133 8.0E-12
sp|A5W713|ACP_PSEP1 Acyl carrier protein OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=acpP PE=3 SV=1 81 133 8.0E-12
sp|Q5LR57|ACP_RUEPO Acyl carrier protein OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=acpP PE=3 SV=1 79 133 8.0E-12
sp|Q8K9J4|ACP_BUCAP Acyl carrier protein OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=acpP PE=3 SV=1 81 136 8.0E-12
sp|A7HDZ1|ACP_ANADF Acyl carrier protein OS=Anaeromyxobacter sp. (strain Fw109-5) GN=acpP PE=3 SV=1 83 133 8.0E-12
sp|P80920|ACP_LEUMU Acyl carrier protein OS=Leucothrix mucor GN=acpP PE=1 SV=2 79 133 8.0E-12
sp|A9IRV7|ACP_BART1 Acyl carrier protein OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acpP PE=3 SV=1 81 133 9.0E-12
sp|Q6G056|ACP_BARQU Acyl carrier protein OS=Bartonella quintana (strain Toulouse) GN=acpP PE=3 SV=1 81 133 9.0E-12
sp|P80918|ACP_COMTE Acyl carrier protein OS=Comamonas testosteroni GN=acpP PE=1 SV=2 63 132 9.0E-12
sp|Q494E2|ACP_BLOPB Acyl carrier protein OS=Blochmannia pennsylvanicus (strain BPEN) GN=acpP PE=3 SV=1 81 135 9.0E-12
sp|A0LNX9|ACP_SYNFM Acyl carrier protein OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acpP PE=3 SV=1 79 133 9.0E-12
sp|A9BNK3|ACP_DELAS Acyl carrier protein OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=acpP PE=3 SV=1 63 132 9.0E-12
sp|A1WAX5|ACP_ACISJ Acyl carrier protein OS=Acidovorax sp. (strain JS42) GN=acpP PE=3 SV=1 63 132 9.0E-12
sp|B9MDQ6|ACP_ACIET Acyl carrier protein OS=Acidovorax ebreus (strain TPSY) GN=acpP PE=3 SV=1 63 132 9.0E-12
sp|A1TLE0|ACP_ACIAC Acyl carrier protein OS=Acidovorax citrulli (strain AAC00-1) GN=acpP PE=3 SV=1 63 132 9.0E-12
sp|B0TGW1|ACP_HELMI Acyl carrier protein OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=acpP PE=3 SV=1 74 133 1.0E-11
sp|Q21XP1|ACP_RHOFT Acyl carrier protein OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=acpP PE=3 SV=1 63 132 1.0E-11
sp|Q9ZLS1|ACP_HELPJ Acyl carrier protein OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=acpP PE=3 SV=1 79 133 1.0E-11
sp|Q3AC56|ACP_CARHZ Acyl carrier protein OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=acpP PE=3 SV=1 79 133 1.0E-11
sp|Q6G442|ACP_BARHE Acyl carrier protein OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acpP PE=3 SV=1 81 133 1.0E-11
sp|B8G2S8|ACP_CHLAD Acyl carrier protein OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=acpP PE=3 SV=1 79 133 1.0E-11
sp|Q3JAL0|ACP_NITOC Acyl carrier protein OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=acpP PE=3 SV=1 79 133 1.0E-11
sp|B2UTR8|ACP_HELPS Acyl carrier protein OS=Helicobacter pylori (strain Shi470) GN=acpP PE=3 SV=1 79 133 1.0E-11
sp|B6JLE2|ACP_HELP2 Acyl carrier protein OS=Helicobacter pylori (strain P12) GN=acpP PE=3 SV=1 79 133 1.0E-11
sp|Q126J2|ACP_POLSJ Acyl carrier protein OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=acpP PE=3 SV=1 63 132 1.0E-11
sp|A2SDG2|ACP_METPP Acyl carrier protein OS=Methylibium petroleiphilum (strain PM1) GN=acpP PE=3 SV=1 63 132 1.0E-11
sp|B3QS74|ACP_CHLT3 Acyl carrier protein OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=acpP PE=3 SV=1 80 137 1.0E-11
sp|Q28RW8|ACP_JANSC Acyl carrier protein OS=Jannaschia sp. (strain CCS1) GN=acpP PE=3 SV=1 79 133 1.0E-11
sp|B6JGN3|ACP_OLICO Acyl carrier protein OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=acpP PE=3 SV=1 79 133 1.0E-11
sp|A1U1S9|ACP_MARHV Acyl carrier protein OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acpP PE=3 SV=1 82 134 1.0E-11
sp|Q9RT27|ACP_DEIRA Acyl carrier protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acpP PE=3 SV=2 79 136 2.0E-11
sp|A6QC97|ACP_SULNB Acyl carrier protein OS=Sulfurovum sp. (strain NBC37-1) GN=acpP PE=3 SV=1 80 135 2.0E-11
sp|B3Q9T1|ACP_RHOPT Acyl carrier protein OS=Rhodopseudomonas palustris (strain TIE-1) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|Q135N5|ACP_RHOPS Acyl carrier protein OS=Rhodopseudomonas palustris (strain BisB5) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|Q6N5A8|ACP_RHOPA Acyl carrier protein OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|A1VRU2|ACP_POLNA Acyl carrier protein OS=Polaromonas naphthalenivorans (strain CJ2) GN=acpP PE=3 SV=1 82 132 2.0E-11
sp|Q3SRZ3|ACP_NITWN Acyl carrier protein OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|Q1QKV3|ACP_NITHX Acyl carrier protein OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|A4YT81|ACP_BRASO Acyl carrier protein OS=Bradyrhizobium sp. (strain ORS278) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|A5EIA1|ACP_BRASB Acyl carrier protein OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|Q164P2|ACP_ROSDO Acyl carrier protein OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=acpP PE=3 SV=1 81 133 2.0E-11
sp|B4U7T6|ACP_HYDS0 Acyl carrier protein OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=acpP PE=3 SV=1 81 133 2.0E-11
sp|Q1CTW7|ACP_HELPH Acyl carrier protein OS=Helicobacter pylori (strain HPAG1) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|B5Z6T1|ACP_HELPG Acyl carrier protein OS=Helicobacter pylori (strain G27) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|Q9KA04|ACP_BACHD Acyl carrier protein OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|Q215T1|ACP_RHOPB Acyl carrier protein OS=Rhodopseudomonas palustris (strain BisB18) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|Q2IX87|ACP_RHOP2 Acyl carrier protein OS=Rhodopseudomonas palustris (strain HaA2) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|Q30YL9|ACP_DESAG Acyl carrier protein OS=Desulfovibrio alaskensis (strain G20) GN=acpP PE=3 SV=1 81 133 2.0E-11
sp|Q1J195|ACP_DEIGD Acyl carrier protein OS=Deinococcus geothermalis (strain DSM 11300) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|B1XZN7|ACP_LEPCP Acyl carrier protein OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=acpP PE=3 SV=1 63 139 2.0E-11
sp|A7IK19|ACP_XANP2 Acyl carrier protein OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|A3DDY8|ACP_CLOTH Acyl carrier protein OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=acpP PE=3 SV=1 79 135 2.0E-11
sp|A8HVH0|ACP_AZOC5 Acyl carrier protein OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=acpP PE=3 SV=1 79 133 2.0E-11
sp|A5EXE0|ACP_DICNV Acyl carrier protein OS=Dichelobacter nodosus (strain VCS1703A) GN=acpP PE=3 SV=1 63 133 3.0E-11
sp|Q89MV8|ACP_BRADU Acyl carrier protein OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acpP PE=3 SV=1 79 133 3.0E-11
sp|B9JUU8|ACP_AGRVS Acyl carrier protein OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=acpP PE=3 SV=1 87 133 3.0E-11
sp|B1J4Z1|ACP_PSEPW Acyl carrier protein OS=Pseudomonas putida (strain W619) GN=acpP PE=3 SV=1 89 133 3.0E-11
sp|B0KF56|ACP_PSEPG Acyl carrier protein OS=Pseudomonas putida (strain GB-1) GN=acpP PE=3 SV=1 89 133 3.0E-11
sp|A7GWR1|ACP_CAMC5 Acyl carrier protein OS=Campylobacter curvus (strain 525.92) GN=acpP PE=3 SV=1 79 133 3.0E-11
sp|A5FKU7|ACP_FLAJ1 Acyl carrier protein OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=acpP PE=3 SV=1 75 133 3.0E-11
sp|P56464|ACP_HELPY Acyl carrier protein OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=acpP PE=3 SV=1 79 133 3.0E-11
sp|Q0AQC8|ACP_MARMM Acyl carrier protein OS=Maricaulis maris (strain MCS10) GN=acpP PE=3 SV=1 81 133 3.0E-11
sp|A1WMX2|ACP_VEREI Acyl carrier protein OS=Verminephrobacter eiseniae (strain EF01-2) GN=acpP PE=3 SV=1 63 132 3.0E-11
sp|A0M6S7|ACP_GRAFK Acyl carrier protein OS=Gramella forsetii (strain KT0803) GN=acpP PE=3 SV=1 75 133 3.0E-11
sp|Q31HR4|ACP_THICR Acyl carrier protein OS=Thiomicrospira crunogena (strain XCL-2) GN=acpP PE=3 SV=1 79 133 4.0E-11
sp|B8J187|ACP_DESDA Acyl carrier protein OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=acpP PE=3 SV=1 81 133 4.0E-11
sp|A5FYQ3|ACP_ACICJ Acyl carrier protein OS=Acidiphilium cryptum (strain JF-5) GN=acpP PE=3 SV=1 79 133 4.0E-11
sp|A7ZF37|ACP_CAMC1 Acyl carrier protein OS=Campylobacter concisus (strain 13826) GN=acpP PE=3 SV=1 79 133 4.0E-11
sp|Q97IA5|ACP_CLOAB Acyl carrier protein OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=acpP PE=3 SV=1 79 133 4.0E-11
sp|A0L8T8|ACP_MAGMM Acyl carrier protein OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acpP PE=3 SV=1 79 133 4.0E-11
sp|B9LDT1|ACP_CHLSY Acyl carrier protein OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=acpP PE=3 SV=1 79 133 4.0E-11
sp|A9WKH6|ACP_CHLAA Acyl carrier protein OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=acpP PE=3 SV=1 79 133 4.0E-11
sp|B6IN76|ACP_RHOCS Acyl carrier protein OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=acpP PE=3 SV=1 82 140 5.0E-11
sp|Q2W5G4|ACP_MAGSA Acyl carrier protein OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=acpP PE=3 SV=1 83 133 5.0E-11
sp|A8FD57|ACP_BACP2 Acyl carrier protein OS=Bacillus pumilus (strain SAFR-032) GN=acpP PE=3 SV=1 79 137 5.0E-11
sp|Q7MU10|ACP_PORGI Acyl carrier protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=acpP PE=3 SV=1 62 133 5.0E-11
sp|B2RLH9|ACP_PORG3 Acyl carrier protein OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=acpP PE=3 SV=1 62 133 5.0E-11
sp|C1A8W8|ACP_GEMAT Acyl carrier protein OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acpP PE=3 SV=1 81 133 7.0E-11
sp|Q11V97|ACP_CYTH3 Acyl carrier protein OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=acpP PE=3 SV=1 83 133 7.0E-11
sp|B7I7A7|ACP_ACIB5 Acyl carrier protein OS=Acinetobacter baumannii (strain AB0057) GN=acpP PE=3 SV=1 81 133 7.0E-11
sp|B7GYR8|ACP_ACIB3 Acyl carrier protein OS=Acinetobacter baumannii (strain AB307-0294) GN=acpP PE=3 SV=1 81 133 7.0E-11
sp|A6KZ78|ACP_BACV8 Acyl carrier protein OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=acpP PE=3 SV=1 75 133 8.0E-11
sp|C1D0N8|ACP_DEIDV Acyl carrier protein OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=acpP PE=3 SV=1 79 133 8.0E-11
sp|A5URZ0|ACP_ROSS1 Acyl carrier protein OS=Roseiflexus sp. (strain RS-1) GN=acpP PE=3 SV=1 79 133 8.0E-11
sp|C4XNY7|ACP_DESMR Acyl carrier protein OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=acpP PE=3 SV=1 79 133 8.0E-11
sp|Q6FDT7|ACP_ACIAD Acyl carrier protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acpP PE=3 SV=2 81 133 9.0E-11
sp|A0RQM2|ACP_CAMFF Acyl carrier protein OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=acpP PE=3 SV=1 74 133 1.0E-10
sp|Q5NN07|ACP_ZYMMO Acyl carrier protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=acpP PE=3 SV=1 79 133 2.0E-10
sp|Q1AW83|ACP_RUBXD Acyl carrier protein OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acpP PE=3 SV=1 79 139 2.0E-10
sp|Q8A2E6|ACP_BACTN Acyl carrier protein OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=acpP PE=3 SV=1 83 133 2.0E-10
sp|Q2G8P0|ACP_NOVAD Acyl carrier protein OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acpP PE=3 SV=1 81 133 2.0E-10
sp|Q1GWG9|ACP_SPHAL Acyl carrier protein OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=acpP PE=3 SV=1 81 133 2.0E-10
sp|Q4L5T4|ACP_STAHJ Acyl carrier protein OS=Staphylococcus haemolyticus (strain JCSC1435) GN=acpP PE=3 SV=1 71 133 2.0E-10
sp|Q8CPI2|ACP_STAES Acyl carrier protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=acpP PE=3 SV=1 71 133 2.0E-10
sp|Q5HPV9|ACP_STAEQ Acyl carrier protein OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=acpP PE=3 SV=1 71 133 2.0E-10
sp|A7HZZ5|ACP_CAMHC Acyl carrier protein OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=acpP PE=3 SV=1 80 135 2.0E-10
sp|P63449|ACP_XYLFT Acyl carrier protein OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acpP PE=3 SV=1 63 133 2.0E-10
sp|B0U3X4|ACP_XYLFM Acyl carrier protein OS=Xylella fastidiosa (strain M12) GN=acpP PE=3 SV=1 63 133 2.0E-10
sp|P63448|ACP_XYLFA Acyl carrier protein OS=Xylella fastidiosa (strain 9a5c) GN=acpP PE=3 SV=1 63 133 2.0E-10
sp|B2I798|ACP_XYLF2 Acyl carrier protein OS=Xylella fastidiosa (strain M23) GN=acpP PE=3 SV=1 63 133 2.0E-10
sp|A7NP13|ACP_ROSCS Acyl carrier protein OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=acpP PE=3 SV=1 79 133 2.0E-10
sp|Q17XQ6|ACP_HELAH Acyl carrier protein OS=Helicobacter acinonychis (strain Sheeba) GN=acpP PE=3 SV=1 79 133 2.0E-10
sp|Q49X16|ACP_STAS1 Acyl carrier protein OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=acpP PE=3 SV=1 71 133 3.0E-10
sp|Q64ZV7|ACP_BACFR Acyl carrier protein OS=Bacteroides fragilis (strain YCH46) GN=acpP PE=3 SV=1 75 133 3.0E-10
sp|Q5LIS0|ACP_BACFN Acyl carrier protein OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=acpP PE=3 SV=1 75 133 3.0E-10
sp|B9KF13|ACP_CAMLR Acyl carrier protein OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=acpP PE=3 SV=1 79 135 3.0E-10
sp|Q6B8U3|ACP_GRATL Acyl carrier protein OS=Gracilaria tenuistipitata var. liui GN=acpP PE=3 SV=1 74 133 3.0E-10
sp|Q5HW23|ACP_CAMJR Acyl carrier protein OS=Campylobacter jejuni (strain RM1221) GN=acpP PE=3 SV=1 79 135 3.0E-10
sp|B2UQS2|ACP_AKKM8 Acyl carrier protein OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=acpP PE=3 SV=1 79 133 3.0E-10
sp|Q2NBQ2|ACP_ERYLH Acyl carrier protein OS=Erythrobacter litoralis (strain HTCC2594) GN=acpP PE=3 SV=1 75 133 3.0E-10
sp|C0ZFP2|ACP_BREBN Acyl carrier protein OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=acpP PE=3 SV=1 79 133 3.0E-10
sp|P63439|ACP_LISMO Acyl carrier protein OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=acpP PE=3 SV=1 83 133 3.0E-10
sp|B8DDU6|ACP_LISMH Acyl carrier protein OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=acpP PE=3 SV=1 83 133 3.0E-10
sp|Q71YL0|ACP_LISMF Acyl carrier protein OS=Listeria monocytogenes serotype 4b (strain F2365) GN=acpP PE=3 SV=1 83 133 3.0E-10
sp|C1KWA5|ACP_LISMC Acyl carrier protein OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=acpP PE=3 SV=1 83 133 3.0E-10
sp|P63440|ACP_LISIN Acyl carrier protein OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=acpP PE=3 SV=1 83 133 3.0E-10
sp|P94123|ACP_AZOBR Acyl carrier protein OS=Azospirillum brasilense GN=acpP PE=1 SV=3 83 133 5.0E-10
sp|A7H4T8|ACP_CAMJD Acyl carrier protein OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=acpP PE=3 SV=1 79 135 5.0E-10
sp|A1VYF9|ACP_CAMJJ Acyl carrier protein OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acpP PE=3 SV=1 79 135 5.0E-10
sp|Q9PI64|ACP_CAMJE Acyl carrier protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acpP PE=3 SV=1 79 135 5.0E-10
sp|A8FKM8|ACP_CAMJ8 Acyl carrier protein OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acpP PE=3 SV=1 79 135 5.0E-10
sp|A9VT88|ACP_BACWK Acyl carrier protein OS=Bacillus weihenstephanensis (strain KBAB4) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|B1XJG7|ACP_SYNP2 Acyl carrier protein OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=acpP PE=3 SV=1 79 133 6.0E-10
sp|P12784|ACP_RHOSH Acyl carrier protein OS=Rhodobacter sphaeroides GN=acpP PE=1 SV=3 81 129 6.0E-10
sp|Q6HEW5|ACP_BACHK Acyl carrier protein OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|Q636H6|ACP_BACCZ Acyl carrier protein OS=Bacillus cereus (strain ZK / E33L) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|Q819V7|ACP_BACCR Acyl carrier protein OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=acpP PE=3 SV=2 82 133 6.0E-10
sp|B9IVD9|ACP_BACCQ Acyl carrier protein OS=Bacillus cereus (strain Q1) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|A7GRI0|ACP_BACCN Acyl carrier protein OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|B7HLI3|ACP_BACC7 Acyl carrier protein OS=Bacillus cereus (strain AH187) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|B7HDX3|ACP_BACC4 Acyl carrier protein OS=Bacillus cereus (strain B4264) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|C1EP74|ACP_BACC3 Acyl carrier protein OS=Bacillus cereus (strain 03BB102) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|B7IUK9|ACP_BACC2 Acyl carrier protein OS=Bacillus cereus (strain G9842) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|Q732M0|ACP_BACC1 Acyl carrier protein OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|B7JJT7|ACP_BACC0 Acyl carrier protein OS=Bacillus cereus (strain AH820) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|Q81WI7|ACP_BACAN Acyl carrier protein OS=Bacillus anthracis GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|C3L777|ACP_BACAC Acyl carrier protein OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|C3P5Q1|ACP_BACAA Acyl carrier protein OS=Bacillus anthracis (strain A0248) GN=acpP PE=3 SV=1 82 133 6.0E-10
sp|B9DPJ1|ACP_STACT Acyl carrier protein OS=Staphylococcus carnosus (strain TM300) GN=acpP PE=3 SV=1 71 135 7.0E-10
sp|Q65JQ6|ACP_BACLD Acyl carrier protein OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=acpP PE=3 SV=1 79 133 8.0E-10
sp|P0A003|ACP_STAAW Acyl carrier protein OS=Staphylococcus aureus (strain MW2) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|A8Z3R8|ACP_STAAT Acyl carrier protein OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|Q6G9Y1|ACP_STAAS Acyl carrier protein OS=Staphylococcus aureus (strain MSSA476) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|Q6GHK3|ACP_STAAR Acyl carrier protein OS=Staphylococcus aureus (strain MRSA252) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|P0A002|ACP_STAAN Acyl carrier protein OS=Staphylococcus aureus (strain N315) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|P0A001|ACP_STAAM Acyl carrier protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|A6QGD2|ACP_STAAE Acyl carrier protein OS=Staphylococcus aureus (strain Newman) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|Q5HGK0|ACP_STAAC Acyl carrier protein OS=Staphylococcus aureus (strain COL) GN=acpP PE=1 SV=1 71 133 8.0E-10
sp|Q2YXI4|ACP_STAAB Acyl carrier protein OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|A5ISB7|ACP_STAA9 Acyl carrier protein OS=Staphylococcus aureus (strain JH9) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|Q2FZ51|ACP_STAA8 Acyl carrier protein OS=Staphylococcus aureus (strain NCTC 8325) GN=acpP PE=2 SV=1 71 133 8.0E-10
sp|Q2FHK6|ACP_STAA3 Acyl carrier protein OS=Staphylococcus aureus (strain USA300) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|A6U151|ACP_STAA2 Acyl carrier protein OS=Staphylococcus aureus (strain JH1) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|A7X1J8|ACP_STAA1 Acyl carrier protein OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=acpP PE=3 SV=1 71 133 8.0E-10
sp|A0AJR1|ACP_LISW6 Acyl carrier protein OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=acpP PE=3 SV=1 83 133 1.0E-09
sp|P10352|ACP1_BRANA Acyl carrier protein, chloroplastic OS=Brassica napus GN=ACL1.A1 PE=2 SV=2 77 133 1.0E-09
sp|Q5L0Q4|ACP_GEOKA Acyl carrier protein OS=Geobacillus kaustophilus (strain HTA426) GN=acpP PE=3 SV=1 79 133 2.0E-09
sp|Q3Z708|ACP_DEHM1 Acyl carrier protein OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=acpP PE=3 SV=1 81 133 2.0E-09
sp|P27060|ACP_CYLSN Acyl carrier protein OS=Cylindrotheca sp. (strain N1) GN=acpP PE=3 SV=2 79 136 3.0E-09
sp|Q0C089|ACP_HYPNA Acyl carrier protein OS=Hyphomonas neptunium (strain ATCC 15444) GN=acpP PE=3 SV=1 81 133 3.0E-09
sp|P11829|ACP1_ARATH Acyl carrier protein 1, chloroplastic OS=Arabidopsis thaliana GN=ACP1 PE=1 SV=1 9 133 4.0E-09
sp|A0T0F8|ACP_PHATC Acyl carrier protein OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=acpP PE=3 SV=1 79 133 4.0E-09
sp|B8FJ70|ACP_DESAA Acyl carrier protein OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acpP PE=3 SV=1 79 133 4.0E-09
sp|O52658|ACP2_PSEAE Acyl carrier protein 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acpP2 PE=3 SV=1 82 133 5.0E-09
sp|Q1RKB8|ACP_RICBR Acyl carrier protein OS=Rickettsia bellii (strain RML369-C) GN=acpP PE=3 SV=1 81 133 6.0E-09
sp|Q74IP1|ACP_LACJO Acyl carrier protein OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=acpP PE=3 SV=1 79 133 6.0E-09
sp|Q8ER06|ACP_OCEIH Acyl carrier protein OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=acpP PE=3 SV=1 83 133 7.0E-09
sp|B2A2M9|ACP_NATTJ Acyl carrier protein OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=acpP PE=3 SV=1 74 133 1.0E-08
sp|Q24U44|ACP_DESHY Acyl carrier protein OS=Desulfitobacterium hafniense (strain Y51) GN=acpP PE=3 SV=1 74 133 1.0E-08
sp|B8FRS2|ACP_DESHD Acyl carrier protein OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=acpP PE=3 SV=1 74 133 1.0E-08
sp|A8GY19|ACP_RICB8 Acyl carrier protein OS=Rickettsia bellii (strain OSU 85-389) GN=acpP PE=3 SV=1 81 133 1.0E-08
sp|A0LT89|ACP_ACIC1 Acyl carrier protein OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=acpP PE=3 SV=1 57 135 2.0E-08
sp|Q5WFM5|ACP_BACSK Acyl carrier protein OS=Bacillus clausii (strain KSM-K16) GN=acpP PE=3 SV=1 83 135 2.0E-08
sp|P49517|ACP_ODOSI Acyl carrier protein OS=Odontella sinensis GN=acpP PE=3 SV=1 83 133 2.0E-08
sp|B0BV67|ACP_RICRO Acyl carrier protein OS=Rickettsia rickettsii (strain Iowa) GN=acpP PE=3 SV=1 61 133 2.0E-08
sp|A8EZW3|ACP_RICCK Acyl carrier protein OS=Rickettsia canadensis (strain McKiel) GN=acpP PE=3 SV=1 61 133 2.0E-08
sp|Q3ZYI8|ACP_DEHMC Acyl carrier protein OS=Dehalococcoides mccartyi (strain CBDB1) GN=acpP PE=3 SV=1 87 133 2.0E-08
sp|A5FQ52|ACP_DEHMB Acyl carrier protein OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=acpP PE=3 SV=1 87 133 2.0E-08
sp|P08971|ACP5_BRANA Acyl carrier protein, chloroplastic OS=Brassica napus GN=ACL1.C1 PE=2 SV=1 77 133 2.0E-08
sp|O04652|ACP5_ARATH Acyl carrier protein 5, chloroplastic OS=Arabidopsis thaliana GN=ACP5 PE=3 SV=1 16 133 3.0E-08
sp|Q9PKF8|ACP_CHLMU Acyl carrier protein OS=Chlamydia muridarum (strain MoPn / Nigg) GN=acpP PE=3 SV=1 80 133 3.0E-08
sp|A8F2Q2|ACP_RICM5 Acyl carrier protein OS=Rickettsia massiliae (strain Mtu5) GN=acpP PE=3 SV=1 61 133 3.0E-08
sp|Q4UK61|ACP_RICFE Acyl carrier protein OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=acpP PE=3 SV=1 61 133 3.0E-08
sp|Q92GD8|ACP_RICCN Acyl carrier protein OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=acpP PE=3 SV=1 61 133 3.0E-08
sp|C3PLP2|ACP_RICAE Acyl carrier protein OS=Rickettsia africae (strain ESF-5) GN=acpP PE=3 SV=1 61 133 3.0E-08
sp|Q5FJI8|ACP_LACAC Acyl carrier protein OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=acpP PE=3 SV=1 58 133 4.0E-08
sp|A8Z6C5|ACP_SULMW Acyl carrier protein OS=Sulcia muelleri (strain GWSS) GN=acpP PE=3 SV=1 79 133 4.0E-08
sp|P08817|ACP2_HORVU Acyl carrier protein 2, chloroplastic OS=Hordeum vulgare GN=ACL1.2 PE=1 SV=2 52 133 4.0E-08
sp|Q68VY6|ACP_RICTY Acyl carrier protein OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=acpP PE=3 SV=2 61 133 5.0E-08
sp|Q9ZCH9|ACP_RICPR Acyl carrier protein OS=Rickettsia prowazekii (strain Madrid E) GN=acpP PE=1 SV=1 61 133 5.0E-08
sp|O84239|ACP_CHLTR Acyl carrier protein OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=acpP PE=3 SV=1 80 133 9.0E-08
sp|Q3KMC6|ACP_CHLTA Acyl carrier protein OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=acpP PE=3 SV=1 80 133 9.0E-08
sp|Q92P51|ACPXL_RHIME Acyl carrier protein AcpXL OS=Rhizobium meliloti (strain 1021) GN=acpXL PE=3 SV=1 68 116 1.0E-07
sp|B2S447|ACP_TREPS Acyl carrier protein OS=Treponema pallidum subsp. pallidum (strain SS14) GN=acpP PE=3 SV=1 82 133 1.0E-07
sp|O83786|ACP_TREPA Acyl carrier protein OS=Treponema pallidum (strain Nichols) GN=acpP PE=3 SV=1 82 133 1.0E-07
sp|B3ETI4|ACP_AMOA5 Acyl carrier protein OS=Amoebophilus asiaticus (strain 5a2) GN=acpP PE=3 SV=1 80 133 1.0E-07
sp|Q73NX6|ACP_TREDE Acyl carrier protein OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=acpP PE=3 SV=1 79 136 1.0E-07
sp|B6YR21|ACP_AZOPC Acyl carrier protein OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=acpP PE=3 SV=1 62 133 1.0E-07
sp|B0BBL7|ACP_CHLTB Acyl carrier protein OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=acpP PE=3 SV=1 80 133 1.0E-07
sp|B0B7F2|ACP_CHLT2 Acyl carrier protein OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=acpP PE=3 SV=1 80 133 1.0E-07
sp|P25702|ACP3_ARATH Acyl carrier protein 3, chloroplastic OS=Arabidopsis thaliana GN=ACP3 PE=1 SV=2 77 133 2.0E-07
sp|P25701|ACP2_ARATH Acyl carrier protein 2, chloroplastic OS=Arabidopsis thaliana GN=ACP2 PE=1 SV=2 77 133 2.0E-07
sp|P07088|ACP_BRACM Acyl carrier protein SF2, chloroplastic OS=Brassica campestris GN=Acl1.1 PE=2 SV=1 52 126 3.0E-07
sp|P93092|ACP1_CASGL Acyl carrier protein 1, chloroplastic OS=Casuarina glauca GN=ACP1 PE=2 SV=1 12 133 3.0E-07
sp|Q9SW21|ACP4_ARATH Acyl carrier protein 4, chloroplastic OS=Arabidopsis thaliana GN=ACP4 PE=2 SV=1 93 133 3.0E-07
sp|Q8UF02|ACPXL_AGRFC Acyl carrier protein AcpXL OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acpXL PE=3 SV=2 68 116 5.0E-07
sp|P17650|ACP2_BRANA Acyl carrier protein, chloroplastic OS=Brassica napus GN=ACL1.A2 PE=2 SV=1 77 126 5.0E-07
sp|Q5L605|ACP_CHLAB Acyl carrier protein OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=acpP PE=3 SV=1 79 133 5.0E-07
sp|P23235|ACP2_SPIOL Acyl carrier protein 2, chloroplastic OS=Spinacia oleracea GN=ACL1.2 PE=1 SV=1 91 133 8.0E-07
sp|Q8XPI1|ACP3_RALSO Acyl carrier protein 3 OS=Ralstonia solanacearum (strain GMI1000) GN=acpP3 PE=3 SV=1 81 133 8.0E-07
sp|Q9Z8P3|ACP_CHLPN Acyl carrier protein OS=Chlamydia pneumoniae GN=acpP PE=3 SV=1 79 133 8.0E-07
sp|P32887|ACP3_BRANA Acyl carrier protein, chloroplastic OS=Brassica napus GN=ACL1.A3 PE=2 SV=1 77 126 9.0E-07
sp|B1V902|ACP_PHYAS Acyl carrier protein OS=Phytoplasma australiense GN=acpP PE=3 SV=1 79 133 1.0E-06
sp|P15543|ACP3_HORVU Acyl carrier protein 3, chloroplastic OS=Hordeum vulgare GN=ACL1.3 PE=1 SV=2 91 133 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9232
MFRTAVLRSVASAARAATRPAFTVSRSSQLVARQAAAPVAPRLQSLVAVRMYSAGGALNKEQVEGRIMSLLHGFD
KVNDPENIKPKAHFANDLGLDSLDTVEVVMAIEEEFSIEIPDKDADTIHSIDKAVEYILNQPDAC*
Coding >Hirsu2|9232
ATGTTCCGCACCGCCGTCCTCCGCTCCGTGGCCTCGGCCGCCCGCGCCGCCACTCGTCCAGCCTTCACCGTCTCA
AGATCGTCGCAGCTCGTCGCCCGCCAGGCCGCCGCACCTGTCGCTCCCCGTCTCCAAAGCCTCGTCGCCGTCAGG
ATGTACAGCGCCGGGGGCGCTCTGAACAAAGAGCAGGTCGAGGGCCGCATCATGAGTCTGCTGCATGGCTTTGAC
AAGGTCAATGACCCGGAAAATATCAAGCCCAAAGCCCACTTCGCCAACGACCTGGGCCTCGACAGCCTCGACACG
GTCGAGGTTGTCATGGCCATTGAGGAGGAATTCAGCATCGAGATTCCCGACAAGGATGCCGACACCATTCACTCC
ATTGACAAGGCAGTCGAGTACATCCTGAATCAGCCCGATGCTTGCTAA
Transcript >Hirsu2|9232
ATGTTCCGCACCGCCGTCCTCCGCTCCGTGGCCTCGGCCGCCCGCGCCGCCACTCGTCCAGCCTTCACCGTCTCA
AGATCGTCGCAGCTCGTCGCCCGCCAGGCCGCCGCACCTGTCGCTCCCCGTCTCCAAAGCCTCGTCGCCGTCAGG
ATGTACAGCGCCGGGGGCGCTCTGAACAAAGAGCAGGTCGAGGGCCGCATCATGAGTCTGCTGCATGGCTTTGAC
AAGGTCAATGACCCGGAAAATATCAAGCCCAAAGCCCACTTCGCCAACGACCTGGGCCTCGACAGCCTCGACACG
GTCGAGGTTGTCATGGCCATTGAGGAGGAATTCAGCATCGAGATTCCCGACAAGGATGCCGACACCATTCACTCC
ATTGACAAGGCAGTCGAGTACATCCTGAATCAGCCCGATGCTTGCTAA
Gene >Hirsu2|9232
ATGTTCCGCACCGCCGTCCTCCGCTCCGTGGCCTCGGCCGCCCGCGCCGCCACTCGTCCAGCCTTCACCGTCTCA
AGATCGTCGCAGCTCGTCGCCCGCCAGGCCGCCGCACCTGTCGCTCCCCGTCTCCAAAGCCTCGTCGCCGTCAGG
ATGTACAGCGCCGGGGGCGCTCTGAACAAAGAGCAGGTCGAGGGCCGCATCATGAGTCTGCTGCATGGCTTTGAC
AAGGCAAGCCGTTGCTCCGCCCCCCCCCCCCCCTTCGCATCTCCCCCGTCTGCTAGCCGAGCTCTGCTCCCCAGC
TCCTTCACTGCTGTCCTTGCGCATCCGTTGCTAATACTTTGTCGTCTCAACAGGTCAATGACCCGGAAAATGTAC
GAACTTGGACACCGAGAGACCAGATAGCAGCTTCTCCTCGATGAAAATGGTCAGCATCTGACTTTTGGTGATACA
GATCAAGCCCAAAGCCCACTTCGCCAACGACCTGGGCCTCGACAGCCTCGACACGGTCGAGGTTGTCATGGCCAT
TGAGGAGGAATTCAGCATCGAGATTCCCGACAAGGATGCCGACACCATTCACTCCAGTGCGTCTTGTCGCGAAAC
AGCCATCCTGCCCCACGATCCGTCGCCGTGCCCGCTAACACGAACTCCGCCGTGGTAGTTGACAAGGCAGTCGAG
TACATCCTGAATCAGCCCGATGCTTGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail