Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9228
Gene name
LocationContig_658:8622..10036
Strand+
Gene length (bp)1414
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08711 Med26 TFIIS helical bundle-like domain 5.0E-11 270 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ11|IWS1_GIBZE Transcription factor IWS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=IWS1 PE=3 SV=1 1 426 0.0E+00
sp|Q870S2|IWS1_NEUCR Transcription factor iws-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iws-1 PE=3 SV=1 17 423 5.0E-127
sp|Q4WSM6|IWS1_ASPFU Transcription factor iws1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iws1 PE=3 SV=1 5 418 4.0E-105
sp|Q5BEG5|IWS1_EMENI Transcription factor iws1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=iws1 PE=3 SV=2 22 418 1.0E-98
sp|Q6CGB2|IWS1_YARLI Transcription factor IWS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IWS1 PE=3 SV=1 147 394 3.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ11|IWS1_GIBZE Transcription factor IWS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=IWS1 PE=3 SV=1 1 426 0.0E+00
sp|Q870S2|IWS1_NEUCR Transcription factor iws-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iws-1 PE=3 SV=1 17 423 5.0E-127
sp|Q4WSM6|IWS1_ASPFU Transcription factor iws1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iws1 PE=3 SV=1 5 418 4.0E-105
sp|Q5BEG5|IWS1_EMENI Transcription factor iws1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=iws1 PE=3 SV=2 22 418 1.0E-98
sp|Q6CGB2|IWS1_YARLI Transcription factor IWS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IWS1 PE=3 SV=1 147 394 3.0E-49
sp|Q5AAR0|IWS1_CANAL Transcription factor IWS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IWS1 PE=3 SV=1 148 421 4.0E-45
sp|O42964|IWS1_SCHPO Transcription factor iws1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iws1 PE=3 SV=1 34 391 3.0E-43
sp|Q6BQ49|IWS1_DEBHA Transcription factor IWS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IWS1 PE=3 SV=2 150 421 7.0E-43
sp|Q4P7X6|IWS1_USTMA Transcription factor IWS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=IWS1 PE=3 SV=2 141 395 9.0E-43
sp|Q6FVX3|IWS1_CANGA Transcription factor IWS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IWS1 PE=3 SV=1 150 344 2.0E-41
sp|Q06505|IWS1_YEAST Transcription factor SPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPN1 PE=1 SV=1 129 339 2.0E-39
sp|Q75EH2|IWS1_ASHGO Transcription factor IWS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IWS1 PE=3 SV=1 154 341 4.0E-38
sp|Q6CVL1|IWS1_KLULA Transcription factor IWS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IWS1 PE=3 SV=1 174 341 2.0E-37
sp|P0CO38|IWS1_CRYNJ Transcription factor IWS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=IWS1 PE=3 SV=1 153 336 7.0E-27
sp|P0CO39|IWS1_CRYNB Transcription factor IWS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=IWS1 PE=3 SV=1 153 336 7.0E-27
sp|Q3SWT4|IWS1_RAT Protein IWS1 homolog OS=Rattus norvegicus GN=Iws1 PE=1 SV=1 167 393 2.0E-20
sp|Q8C1D8|IWS1_MOUSE Protein IWS1 homolog OS=Mus musculus GN=Iws1 PE=1 SV=1 167 424 3.0E-20
sp|Q96ST2|IWS1_HUMAN Protein IWS1 homolog OS=Homo sapiens GN=IWS1 PE=1 SV=2 167 393 3.0E-20
sp|Q505H7|IWS1_XENTR Protein IWS1 homolog OS=Xenopus tropicalis GN=iws1 PE=2 SV=1 167 393 3.0E-20
sp|Q6DE96|IWS1A_XENLA Protein IWS1 homolog A OS=Xenopus laevis GN=iws1-a PE=2 SV=1 167 393 8.0E-20
sp|Q61MR2|IWS1_CAEBR IWS1-like protein OS=Caenorhabditis briggsae GN=iws-1 PE=3 SV=3 175 423 4.0E-17
sp|Q19375|IWS1_CAEEL IWS1-like protein OS=Caenorhabditis elegans GN=iws-1 PE=3 SV=1 181 337 4.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0044464 cell part No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044424 intracellular part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9228
MSDVGSAAGSQANEPIDDLKEQESLDEAGAADSDRDSDLLSEIDENQFEDYDPETANIEDRPVDIDEDIARTLKA
TKRKRTDGDAPKKPREGRREKKRRDRDDEVVAEDDAGTDSGKTQRRSRRAAEGERRRAKEPEAQPEPEKEEELSP
EERRKRAIDRALDAAIKKGGGSSKRRRKDEIDLEDEIDEQLVHLKLQMEKACQADNVARESGQPALHKLKLLPEV
NAILNRNNVQHAVLDPDTNFLQHVKFFLEPLNDGSLPAYNIQRDIFSALTRLNIEKETLLSSGIGKVVLFYTRSK
KPEPSIKRMAERLLGEWSRPILKRTDDYKKRHVETREFDYQAAKLAQRQKAGSQFNLTQRPAQSAREAFLAPQSA
NNRARMASLPSSYTIAPKSTFDGSRGQDHRPLGASGMEAFRKMTQKSKKRA*
Coding >Hirsu2|9228
ATGTCGGACGTGGGCTCGGCTGCTGGCTCGCAGGCCAACGAGCCGATCGACGACTTGAAGGAACAGGAGTCTCTG
GATGAAGCTGGCGCTGCCGACTCGGACCGCGACTCGGACCTCCTGTCGGAAATCGACGAGAATCAGTTCGAAGAC
TACGACCCTGAGACGGCCAACATCGAAGACCGCCCGGTGGATATCGATGAAGACATTGCACGGACGCTCAAGGCG
ACCAAGCGGAAGCGTACCGACGGCGACGCGCCCAAAAAACCCCGAGAGGGCCGTCGGGAGAAGAAGAGACGAGAC
CGTGACGACGAGGTGGTTGCGGAAGACGACGCGGGGACAGACTCAGGCAAGACACAGAGACGATCGAGGCGAGCG
GCCGAGGGAGAGAGACGGCGAGCCAAAGAGCCAGAGGCGCAGCCGGAGCCAGAGAAGGAGGAGGAGCTCAGCCCA
GAGGAGCGGAGGAAGCGGGCCATCGATCGCGCGCTGGATGCGGCCATCAAGAAGGGCGGCGGATCGAGCAAGCGC
CGACGCAAAGACGAGATCGACCTCGAAGACGAGATTGACGAGCAGCTGGTGCACCTCAAGCTTCAGATGGAAAAG
GCCTGCCAGGCCGACAACGTGGCACGCGAATCGGGCCAGCCGGCGCTGCACAAGCTGAAGCTGCTGCCGGAGGTC
AACGCGATTCTGAACCGCAACAATGTCCAGCACGCGGTGCTCGACCCGGACACCAACTTCCTCCAGCACGTCAAG
TTCTTCCTCGAGCCCCTCAACGACGGGTCCCTGCCGGCGTACAACATCCAGCGCGACATCTTCTCGGCGCTGACG
CGGCTGAACATTGAAAAGGAGACGCTGCTGAGCAGCGGCATCGGCAAGGTCGTCCTCTTCTACACACGCAGCAAG
AAGCCCGAGCCCAGCATCAAGCGGATGGCGGAGCGGCTGCTGGGGGAGTGGAGCCGGCCGATTCTGAAGCGGACG
GACGACTACAAGAAGCGCCACGTCGAGACGCGCGAGTTTGACTACCAGGCGGCCAAGCTCGCGCAGCGCCAAAAG
GCGGGTTCGCAGTTCAACCTCACGCAGCGCCCGGCGCAGTCGGCACGAGAGGCGTTCCTCGCGCCGCAGAGCGCC
AACAACCGGGCGCGCATGGCCAGCCTTCCGTCGAGCTACACGATTGCGCCCAAGAGCACCTTTGACGGATCGCGC
GGACAGGATCATCGTCCGCTGGGGGCGAGCGGCATGGAGGCCTTTAGGAAGATGACACAGAAGAGCAAGAAACGG
GCGTGA
Transcript >Hirsu2|9228
ATGTCGGACGTGGGCTCGGCTGCTGGCTCGCAGGCCAACGAGCCGATCGACGACTTGAAGGAACAGGAGTCTCTG
GATGAAGCTGGCGCTGCCGACTCGGACCGCGACTCGGACCTCCTGTCGGAAATCGACGAGAATCAGTTCGAAGAC
TACGACCCTGAGACGGCCAACATCGAAGACCGCCCGGTGGATATCGATGAAGACATTGCACGGACGCTCAAGGCG
ACCAAGCGGAAGCGTACCGACGGCGACGCGCCCAAAAAACCCCGAGAGGGCCGTCGGGAGAAGAAGAGACGAGAC
CGTGACGACGAGGTGGTTGCGGAAGACGACGCGGGGACAGACTCAGGCAAGACACAGAGACGATCGAGGCGAGCG
GCCGAGGGAGAGAGACGGCGAGCCAAAGAGCCAGAGGCGCAGCCGGAGCCAGAGAAGGAGGAGGAGCTCAGCCCA
GAGGAGCGGAGGAAGCGGGCCATCGATCGCGCGCTGGATGCGGCCATCAAGAAGGGCGGCGGATCGAGCAAGCGC
CGACGCAAAGACGAGATCGACCTCGAAGACGAGATTGACGAGCAGCTGGTGCACCTCAAGCTTCAGATGGAAAAG
GCCTGCCAGGCCGACAACGTGGCACGCGAATCGGGCCAGCCGGCGCTGCACAAGCTGAAGCTGCTGCCGGAGGTC
AACGCGATTCTGAACCGCAACAATGTCCAGCACGCGGTGCTCGACCCGGACACCAACTTCCTCCAGCACGTCAAG
TTCTTCCTCGAGCCCCTCAACGACGGGTCCCTGCCGGCGTACAACATCCAGCGCGACATCTTCTCGGCGCTGACG
CGGCTGAACATTGAAAAGGAGACGCTGCTGAGCAGCGGCATCGGCAAGGTCGTCCTCTTCTACACACGCAGCAAG
AAGCCCGAGCCCAGCATCAAGCGGATGGCGGAGCGGCTGCTGGGGGAGTGGAGCCGGCCGATTCTGAAGCGGACG
GACGACTACAAGAAGCGCCACGTCGAGACGCGCGAGTTTGACTACCAGGCGGCCAAGCTCGCGCAGCGCCAAAAG
GCGGGTTCGCAGTTCAACCTCACGCAGCGCCCGGCGCAGTCGGCACGAGAGGCGTTCCTCGCGCCGCAGAGCGCC
AACAACCGGGCGCGCATGGCCAGCCTTCCGTCGAGCTACACGATTGCGCCCAAGAGCACCTTTGACGGATCGCGC
GGACAGGATCATCGTCCGCTGGGGGCGAGCGGCATGGAGGCCTTTAGGAAGATGACACAGAAGAGCAAGAAACGG
GCGTGA
Gene >Hirsu2|9228
ATGTCGGACGTGGGCTCGGCTGCTGGCTCGCAGGCCAACGAGCCGATCGACGACTTGAAGGAACAGGAGTCTCTG
GATGAAGCTGGCGCTGCCGACTCGGACCGCGACTCGGACCTCCTGTCGGAAATCGACGAGAATCAGTTCGAAGAC
TACGACCCTGAGACGGCCAACATCGAAGACCGCCCGGTGGATATCGATGAAGACATTGCACGGACGCTCAAGGCG
ACCAAGCGGAAGCGTACCGACGGCGACGCGCCCAAAAAACCCCGAGAGGGCCGTCGGGAGAAGAAGAGACGAGAC
CGTGACGACGAGGTGGTTGCGGAAGACGACGCGGGGACAGACTCAGGCAAGACACAGAGACGATCGAGGCGAGCG
GCCGAGGGAGAGAGACGGCGAGCCAAAGAGCCAGAGGCGCAGCCGGAGCCAGAGAAGGAGGAGGAGCTCAGCCCA
GAGGAGCGGAGGAAGCGGGCCATCGATCGCGCGCTGGATGCGGCCATCAAGAAGGGCGGCGGATCGAGCAAGCGC
CGACGCAAAGACGAGATCGTGAGAAAGCTGCCCCCGCACTTGGCCTGCCGGGCTCGCTACTCACACAGACGTGCA
GGACCTCGAAGACGAGATTGACGAGCAGCTGGTGCACCTCAAGCTTCAGATGGAAAAGGCCTGCCAGGCCGACAA
CGTGGCACGCGAATCGGGCCAGCCGGCGCTGCACAAGCTGAAGCTGCTGCCGGAGGTCAACGCGATTCTGAACCG
CAACAATGTCCAGCACGCGGTGCTCGACCCGGACACCAACTTCCTCCAGCACGTCAAGTTCTTCCTCGAGCCCCT
CAACGACGGGTCCCTGCCGGCGTACAACATCCAGCGCGACATCTTCTCGGCGCTGACGCGGCTGAACATTGAAAA
GGAGACGCTGCTGAGCAGCGGCATCGGCAAGGTCGTCCTCTTCTACACACGCAGCAAGAAGCCCGAGCCCAGCAT
CAAGCGGATGGCGGAGCGGCTGCTGGGGGAGTGGAGCCGGCCGATTCTGAAGCGGACGGACGACTACAAGAAGCG
CCACGTCGAGACGCGCGAGTTTGACTACCAGTACGTGACGTGTTTGTCGATGATGTCCTGGAGTGAACGATGGAG
GCTCGCGCTGACACAGGGTGATTGCCACAGGGCGGCCAAGCTCGCGCAGCGCCAAAAGGCGGGTTCGCAGTTCAA
CCTCACGCAGCGCCCGGCGCAGTCGGCACGAGAGGCGTTCCTCGCGCCGCAGAGCGCCAACAACCGGGCGCGCAT
GGCCAGCCTTCCGTCGAGCTACACGATTGCGCCCAAGAGCACCTTTGACGGATCGCGCGGACAGGATCATCGTCC
GCTGGGGGCGAGCGGCATGGAGGCCTTTAGGAAGATGACACAGAAGAGCAAGAAACGGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail