Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9227
Gene name
LocationContig_658:6504..8109
Strand-
Gene length (bp)1605
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10104 Brr6_like_C_C Di-sulfide bridge nucleocytoplasmic transport domain 2.9E-38 252 378

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53062|BRR6_YEAST Nucleus export protein BRR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR6 PE=1 SV=1 246 360 3.0E-06

GO

GO Term Description Terminal node
GO:0055088 lipid homeostasis Yes
GO:0031965 nuclear membrane Yes
GO:0044446 intracellular organelle part No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0044464 cell part No
GO:0042592 homeostatic process No
GO:0048878 chemical homeostasis No
GO:0044424 intracellular part No
GO:0016020 membrane No
GO:0065008 regulation of biological quality No
GO:0044422 organelle part No
GO:0044428 nuclear part No
GO:0031090 organelle membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 253 275 22
2 359 378 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9227
MGSRSFEGPMDWEYQDRGPFDPTSPFAQAAKNAQRNMFGTPAKSPSRPSNPFAHLAATPSRPQLAPPQTSRFTPQ
LSSKNTAPPFRNPAFTTPRRPIDEMVLSEASGAEDSPALTETSDYPNDTPETEHRTDRVVGGTVTPLKIDKSSRY
GKSGLLSKKHVSGRGEIQGRRDPSVGLRKRKRHNYDRDVGRQYHAQDSEAWDSDSDDADSRADSRSSTRSKKNDK
QGQLQGPFESFFHALNKYPNTPDHMQRWMQFGANLFLVSVLAYLGWSVVSTVRSDIHKANDMARQELMSRMTECQ
TQYTMNECAKKDRPALRTMCEEWYDCMMQNPESILRVKVTAKQVAEIINEFSETMHLKAWGIVLGFILVCTTVNV
GAFNRQGTHKPSLPSAPAQASEAAAAAAARSPGIGAGYMLVPVQTPRMPRRAMLDEGTDTDTSPLNLKPAPSLLT
PSGRRSPTKLERQLSPVKYGRGSNRGP*
Coding >Hirsu2|9227
ATGGGGTCCCGAAGCTTCGAAGGTCCCATGGACTGGGAATACCAGGACCGAGGCCCGTTCGATCCAACTAGCCCC
TTCGCCCAGGCTGCAAAGAACGCTCAGCGAAACATGTTCGGGACGCCGGCCAAGTCTCCCTCTCGTCCAAGCAAC
CCATTTGCCCACCTCGCAGCAACGCCGTCGAGACCTCAACTTGCGCCCCCCCAGACGTCGCGCTTCACCCCCCAG
CTGTCCTCCAAGAACACGGCGCCTCCGTTCAGGAATCCCGCGTTCACGACGCCAAGGCGACCGATCGATGAGATG
GTGTTGTCCGAGGCATCGGGCGCCGAGGATAGCCCCGCGCTGACGGAAACGTCCGACTACCCCAACGACACCCCC
GAGACCGAGCATAGGACGGACAGGGTAGTCGGGGGCACCGTCACGCCGCTGAAGATTGACAAGTCGAGTCGGTAC
GGGAAGTCGGGGCTCCTCTCGAAGAAGCACGTGTCGGGTAGGGGGGAGATACAGGGGCGCAGAGATCCGTCGGTC
GGCTTGCGGAAGAGGAAACGGCACAACTACGACCGAGACGTCGGCCGCCAATATCACGCCCAAGACAGCGAGGCC
TGGGATTCGGACTCGGACGACGCGGACAGCCGGGCCGACTCTCGCAGCTCGACGCGGTCGAAGAAGAACGACAAG
CAGGGCCAGCTCCAGGGCCCTTTCGAGTCGTTCTTCCACGCGCTCAACAAGTACCCCAACACGCCGGATCATATG
CAGCGGTGGATGCAGTTTGGGGCCAACCTCTTCCTCGTCTCGGTGCTGGCCTATCTGGGCTGGTCCGTCGTCAGC
ACCGTGCGCAGCGACATCCACAAGGCCAACGACATGGCGCGGCAGGAGCTCATGAGCAGGATGACGGAGTGCCAG
ACGCAGTACACGATGAACGAGTGCGCGAAAAAGGACCGGCCGGCGTTGAGGACGATGTGTGAGGAGTGGTACGAC
TGCATGATGCAGAACCCGGAGTCGATCTTGAGGGTCAAAGTCACCGCCAAGCAGGTGGCCGAGATTATCAACGAG
TTTTCCGAGACGATGCACCTCAAGGCCTGGGGCATCGTGCTCGGTTTCATCTTAGTATGCACGACGGTCAATGTA
GGGGCGTTCAACCGGCAAGGGACACACAAGCCCTCGCTGCCGTCGGCACCGGCGCAGGCCAGCGAGGCGGCGGCG
GCAGCGGCGGCAAGATCGCCAGGCATCGGCGCGGGCTACATGCTGGTGCCGGTGCAAACGCCGAGGATGCCCCGG
CGGGCGATGCTGGACGAGGGAACGGACACGGACACGTCGCCGCTCAACCTAAAGCCGGCACCGTCGCTCTTGACG
CCCTCGGGACGCAGGAGCCCGACCAAGCTGGAGAGGCAGCTGAGTCCCGTGAAATACGGTCGGGGCTCGAACCGG
GGGCCGTGA
Transcript >Hirsu2|9227
ATGGGGTCCCGAAGCTTCGAAGGTCCCATGGACTGGGAATACCAGGACCGAGGCCCGTTCGATCCAACTAGCCCC
TTCGCCCAGGCTGCAAAGAACGCTCAGCGAAACATGTTCGGGACGCCGGCCAAGTCTCCCTCTCGTCCAAGCAAC
CCATTTGCCCACCTCGCAGCAACGCCGTCGAGACCTCAACTTGCGCCCCCCCAGACGTCGCGCTTCACCCCCCAG
CTGTCCTCCAAGAACACGGCGCCTCCGTTCAGGAATCCCGCGTTCACGACGCCAAGGCGACCGATCGATGAGATG
GTGTTGTCCGAGGCATCGGGCGCCGAGGATAGCCCCGCGCTGACGGAAACGTCCGACTACCCCAACGACACCCCC
GAGACCGAGCATAGGACGGACAGGGTAGTCGGGGGCACCGTCACGCCGCTGAAGATTGACAAGTCGAGTCGGTAC
GGGAAGTCGGGGCTCCTCTCGAAGAAGCACGTGTCGGGTAGGGGGGAGATACAGGGGCGCAGAGATCCGTCGGTC
GGCTTGCGGAAGAGGAAACGGCACAACTACGACCGAGACGTCGGCCGCCAATATCACGCCCAAGACAGCGAGGCC
TGGGATTCGGACTCGGACGACGCGGACAGCCGGGCCGACTCTCGCAGCTCGACGCGGTCGAAGAAGAACGACAAG
CAGGGCCAGCTCCAGGGCCCTTTCGAGTCGTTCTTCCACGCGCTCAACAAGTACCCCAACACGCCGGATCATATG
CAGCGGTGGATGCAGTTTGGGGCCAACCTCTTCCTCGTCTCGGTGCTGGCCTATCTGGGCTGGTCCGTCGTCAGC
ACCGTGCGCAGCGACATCCACAAGGCCAACGACATGGCGCGGCAGGAGCTCATGAGCAGGATGACGGAGTGCCAG
ACGCAGTACACGATGAACGAGTGCGCGAAAAAGGACCGGCCGGCGTTGAGGACGATGTGTGAGGAGTGGTACGAC
TGCATGATGCAGAACCCGGAGTCGATCTTGAGGGTCAAAGTCACCGCCAAGCAGGTGGCCGAGATTATCAACGAG
TTTTCCGAGACGATGCACCTCAAGGCCTGGGGCATCGTGCTCGGTTTCATCTTAGTATGCACGACGGTCAATGTA
GGGGCGTTCAACCGGCAAGGGACACACAAGCCCTCGCTGCCGTCGGCACCGGCGCAGGCCAGCGAGGCGGCGGCG
GCAGCGGCGGCAAGATCGCCAGGCATCGGCGCGGGCTACATGCTGGTGCCGGTGCAAACGCCGAGGATGCCCCGG
CGGGCGATGCTGGACGAGGGAACGGACACGGACACGTCGCCGCTCAACCTAAAGCCGGCACCGTCGCTCTTGACG
CCCTCGGGACGCAGGAGCCCGACCAAGCTGGAGAGGCAGCTGAGTCCCGTGAAATACGGTCGGGGCTCGAACCGG
GGGCCGTGA
Gene >Hirsu2|9227
ATGGGGTCCCGAAGCTTCGAAGGTCCCATGGACTGGGAATACCAGGACCGAGGCCCGTTCGATCCAACTAGCCCC
TTCGCCCAGGCTGCAAAGAACGCTCAGCGAAACAGTGAGCCACCTTTGCGCGCGGGCCATGGGCCCATGGCGACC
TCTTCCCGCACTGGGAATGATTTGGCAAACAGCTGACTGACGTTACTCGGCAGTGTTCGGGACGCCGGCCAAGTC
TCCCTCTCGTCCAAGCAACCCATTTGCCCACCTCGCAGCAACGCCGTCGAGACCTCAACTTGCGCCCCCCCAGAC
GTCGCGCTTCACCCCCCAGCTGTCCTCCAAGAACACGGCGCCTCCGTTCAGGAATCCCGCGTTCACGACGCCAAG
GCGACCGATCGATGAGATGGTGTTGTCCGAGGCATCGGGCGCCGAGGATAGCCCCGCGCTGACGGAAACGTCCGA
CTACCCCAACGACACCCCCGAGACCGAGCATAGGACGGACAGGGTAGTCGGGGGCACCGTCACGCCGCTGAAGAT
TGACAAGTCGAGTCGGTACGGGAAGTCGGGGCTCCTCTCGAAGAAGCACGTGTCGGGTAGGGGGGAGATACAGGG
GCGCAGAGATCCGTCGGTCGGCTTGCGGAAGAGGAAACGGCACAACTACGACCGAGACGTCGGCCGCCAATATCA
CGCCCAAGACAGCGAGGCCTGGGATTCGGACTCGGACGACGCGGACAGCCGGGCCGACTCTCGCAGCTCGACGCG
GTCGAAGAAGAACGACAAGCAGGGCCAGCTCCAGGGCCCTTTCGAGTCGTTCTTCCACGCGCTCAACAAGTACCC
CAACACGCCGGATCATATGCAGCGGTGGATGCAGTTTGGGGCCAACCTCTTCCTCGTCTCGGTGCTGGCCTATCT
GGGCTGGTCCGTCGTCAGCACCGTGCGCAGCGACATCCACAAGGCCAACGACATGGCGCGGCAGGAGCTCATGAG
CAGGATGACGGAGTGCCAGACGCAGTACACGATGAACGAGTGCGCGAAAAAGGACCGGCCGGCGTTGAGGACGAT
GTGTGAGGAGTGGTACGACTGCATGATGCAGAACCCGGAGTCGATCTTGAGGGTCAAAGTCACCGCCAAGCAGGT
GGCCGAGATTATCAACGAGTTTTCCGAGACGATGCACCTCAAGGCCTGGGTAAGTCTGTCCTTGCCCCCGCTCCC
CCCTGTCCTTCTCTCGGGGGCTGTGCCGGAGTAACCAACGCCGCGTTCCAGGGCATCGTGCTCGGTTTCATCTTA
GTATGCACGACGGTCAATGTAGGGGCGTTCAACCGGCAAGGGACACACAAGCCCTCGCTGCCGTCGGCACCGGCG
CAGGCCAGCGAGGCGGCGGCGGCAGCGGCGGCAAGATCGCCAGGCATCGGCGCGGGCTACATGCTGGTGCCGGTG
CAAACGCCGAGGATGCCCCGGCGGGCGATGCTGGACGAGGGAACGGACACGGACACGTCGCCGCTCAACCTAAAG
CCGGCACCGTCGCTCTTGACGCCCTCGGGACGCAGGAGCCCGACCAAGCTGGAGAGGCAGCTGAGTCCCGTGAAA
TACGGTCGGGGCTCGAACCGGGGGCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail