Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9221
Gene name
LocationContig_657:903..5119
Strand-
Gene length (bp)4216
Transcript length (bp)4101
Coding sequence length (bp)4101
Protein length (aa) 1367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 2.5E-42 52 309
PF00664 ABC_membrane ABC transporter transmembrane region 8.8E-44 751 1022
PF00005 ABC_tran ABC transporter 1.8E-33 403 594
PF00005 ABC_tran ABC transporter 2.8E-27 1113 1285

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 33 1366 0.0E+00
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 46 1356 0.0E+00
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 47 1350 0.0E+00
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 46 1356 0.0E+00
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 46 1356 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 33 1366 0.0E+00
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 46 1356 0.0E+00
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 47 1350 0.0E+00
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 46 1356 0.0E+00
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 46 1356 0.0E+00
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 46 1365 0.0E+00
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 47 1356 0.0E+00
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 46 1352 0.0E+00
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 31 1356 0.0E+00
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 31 1356 0.0E+00
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 19 1356 0.0E+00
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 45 1350 0.0E+00
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 47 1356 0.0E+00
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 46 1356 0.0E+00
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 2 1350 0.0E+00
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 46 1356 0.0E+00
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 19 1356 0.0E+00
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 47 1350 0.0E+00
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 46 1352 0.0E+00
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 21 1363 0.0E+00
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 47 1354 0.0E+00
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 45 1352 0.0E+00
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 45 1350 0.0E+00
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 46 1352 0.0E+00
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 47 1356 3.0E-179
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 46 1352 2.0E-178
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 46 1352 3.0E-178
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 47 1350 5.0E-178
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 45 1352 3.0E-176
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 47 1356 7.0E-173
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 47 1356 4.0E-172
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 16 1354 2.0E-168
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 5 1357 2.0E-163
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 46 1356 1.0E-162
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 91 1356 1.0E-162
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 91 1356 1.0E-159
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 46 1350 2.0E-159
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 35 1357 4.0E-159
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 25 1356 1.0E-153
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 47 1356 2.0E-153
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 46 1356 4.0E-152
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 4 1356 6.0E-147
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 108 1365 2.0E-139
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 47 1364 2.0E-131
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 50 1360 1.0E-114
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 47 1364 6.0E-91
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 35 681 3.0E-85
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 9 663 1.0E-78
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 14 667 1.0E-77
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 89 667 7.0E-76
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1 663 9.0E-76
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 47 666 3.0E-75
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 43 675 1.0E-74
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 68 681 1.0E-74
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 47 666 1.0E-74
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 47 666 2.0E-74
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 47 666 1.0E-73
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 27 666 6.0E-73
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 47 665 4.0E-72
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 50 663 6.0E-72
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 47 665 8.0E-72
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 121 665 9.0E-72
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 47 666 9.0E-72
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 20 669 3.0E-71
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 47 666 3.0E-71
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 47 663 4.0E-71
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 47 662 1.0E-70
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 6 662 1.0E-70
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 47 666 2.0E-70
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 122 664 3.0E-70
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 123 665 3.0E-70
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 47 666 3.0E-70
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 47 662 5.0E-70
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 68 669 5.0E-70
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 50 662 5.0E-70
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 68 669 9.0E-70
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 684 1363 1.0E-69
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 747 1365 3.0E-69
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 44 664 3.0E-69
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 45 664 6.0E-69
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 52 665 7.0E-69
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 47 666 1.0E-68
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 122 665 1.0E-68
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 113 665 2.0E-68
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 122 665 4.0E-68
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 123 665 7.0E-68
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 743 1350 3.0E-67
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 44 665 4.0E-67
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 46 669 6.0E-67
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 747 1364 6.0E-67
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 747 1356 2.0E-66
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 825 1365 2.0E-66
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 725 1350 3.0E-66
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 125 665 4.0E-66
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 213 1352 2.0E-65
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 102 665 4.0E-65
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 738 1363 5.0E-65
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 823 1366 2.0E-64
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 823 1366 5.0E-64
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 747 1366 8.0E-64
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 823 1366 1.0E-63
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 823 1366 2.0E-63
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 747 1366 2.0E-63
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 737 1366 3.0E-63
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 752 1365 5.0E-63
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 823 1366 1.0E-62
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 823 1366 1.0E-62
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 705 1366 7.0E-62
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 731 1365 7.0E-62
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 709 1366 9.0E-62
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 705 1366 1.0E-61
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 823 1366 4.0E-61
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 8 675 5.0E-61
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 114 665 9.0E-61
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 788 1365 1.0E-60
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 795 1366 1.0E-60
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 778 1352 3.0E-60
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 822 1365 4.0E-60
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 818 1365 5.0E-60
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 669 1356 8.0E-60
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 47 667 9.0E-60
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 806 1363 2.0E-59
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 29 665 4.0E-59
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 793 1360 4.0E-59
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 823 1366 6.0E-59
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 47 665 6.0E-59
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 807 1365 8.0E-59
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 698 1365 8.0E-59
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 818 1365 1.0E-58
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 109 668 7.0E-58
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 674 1366 9.0E-58
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 814 1365 5.0E-57
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 783 1363 9.0E-57
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 826 1365 1.0E-56
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 37 669 2.0E-56
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 105 665 3.0E-56
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 129 661 3.0E-56
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 818 1365 4.0E-56
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 120 667 4.0E-56
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 120 667 5.0E-56
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 120 667 5.0E-56
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 89 667 7.0E-56
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 63 674 1.0E-55
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 116 661 3.0E-55
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 116 665 3.0E-55
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 116 665 3.0E-55
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 116 665 3.0E-55
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 116 665 4.0E-55
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 116 665 4.0E-55
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 109 672 9.0E-55
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 116 665 9.0E-55
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 116 665 9.0E-55
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 116 665 9.0E-55
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 818 1363 1.0E-54
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 26 665 1.0E-54
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 116 665 1.0E-54
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 116 665 1.0E-54
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 116 665 1.0E-54
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 116 665 1.0E-54
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 116 665 1.0E-54
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 116 665 1.0E-54
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 116 665 1.0E-54
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 116 665 1.0E-54
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 116 665 1.0E-54
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 116 665 2.0E-54
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 116 665 2.0E-54
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 183 667 3.0E-54
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 725 1363 4.0E-54
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 97 656 4.0E-54
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 806 1356 5.0E-54
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 116 665 6.0E-54
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 71 696 1.0E-53
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 129 665 1.0E-53
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 125 652 1.0E-53
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 744 1365 1.0E-53
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 800 1365 1.0E-53
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 674 1366 1.0E-53
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 710 1349 2.0E-53
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 116 665 3.0E-53
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 116 665 3.0E-53
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 141 653 3.0E-53
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 141 653 4.0E-53
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 111 665 4.0E-53
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 141 653 5.0E-53
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 141 653 5.0E-53
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 112 668 1.0E-52
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 141 665 1.0E-52
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 795 1358 1.0E-52
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 116 665 1.0E-52
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 810 1365 1.0E-52
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 141 665 2.0E-52
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 116 665 2.0E-52
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 101 665 2.0E-52
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 120 639 2.0E-52
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 48 661 3.0E-52
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 729 1356 3.0E-52
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 729 1356 3.0E-52
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 729 1356 3.0E-52
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 729 1356 3.0E-52
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 729 1356 3.0E-52
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 729 1356 3.0E-52
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 729 1356 3.0E-52
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 729 1356 3.0E-52
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 47 1356 3.0E-52
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 141 665 3.0E-52
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 141 665 3.0E-52
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 129 661 3.0E-52
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 795 1358 3.0E-52
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 141 665 3.0E-52
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 141 665 4.0E-52
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 141 665 4.0E-52
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 141 665 4.0E-52
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 141 665 4.0E-52
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 129 671 5.0E-52
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 129 661 6.0E-52
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 141 665 6.0E-52
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 48 665 6.0E-52
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 129 671 7.0E-52
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 101 665 7.0E-52
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 198 1358 1.0E-51
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 125 652 1.0E-51
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 113 665 1.0E-51
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 125 665 2.0E-51
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 729 1356 2.0E-51
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 710 1356 3.0E-51
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 796 1356 3.0E-51
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 799 1351 3.0E-51
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 795 1356 5.0E-51
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 119 665 5.0E-51
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 27 673 5.0E-51
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 116 665 5.0E-51
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 818 1363 7.0E-51
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 129 665 8.0E-51
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 125 664 9.0E-51
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 125 664 9.0E-51
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 141 666 1.0E-50
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 125 664 1.0E-50
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 125 664 1.0E-50
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 367 663 1.0E-50
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 116 665 1.0E-50
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 759 1356 2.0E-50
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 668 1356 2.0E-50
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 795 1356 2.0E-50
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 810 1356 3.0E-50
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 129 665 3.0E-50
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 811 1356 3.0E-50
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 207 1356 3.0E-50
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 102 665 3.0E-50
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 375 673 4.0E-50
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 129 671 4.0E-50
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 92 665 4.0E-50
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 374 669 4.0E-50
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 126 656 5.0E-50
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 141 667 6.0E-50
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 141 666 6.0E-50
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 795 1356 7.0E-50
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 818 1364 7.0E-50
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 101 665 8.0E-50
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 116 661 9.0E-50
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 96 670 1.0E-49
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 200 1356 1.0E-49
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 124 665 1.0E-49
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 116 665 2.0E-49
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 126 658 2.0E-49
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 70 665 2.0E-49
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 808 1356 3.0E-49
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 129 671 3.0E-49
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 106 665 3.0E-49
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 808 1356 4.0E-49
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 127 665 4.0E-49
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 818 1358 4.0E-49
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 759 1350 4.0E-49
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 116 665 4.0E-49
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 63 665 5.0E-49
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 818 1357 6.0E-49
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 810 1366 6.0E-49
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 731 1366 7.0E-49
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 70 675 9.0E-49
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 799 1350 1.0E-48
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 818 1358 1.0E-48
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 96 670 1.0E-48
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 381 667 2.0E-48
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 46 666 2.0E-48
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 795 1356 2.0E-48
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 117 667 2.0E-48
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 807 1356 2.0E-48
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 798 1351 3.0E-48
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 795 1356 3.0E-48
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 795 1356 3.0E-48
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 795 1356 3.0E-48
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 795 1356 3.0E-48
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 140 666 4.0E-48
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 810 1356 4.0E-48
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 818 1357 5.0E-48
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 116 665 5.0E-48
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 808 1356 5.0E-48
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 163 667 7.0E-48
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 808 1356 9.0E-48
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 117 667 1.0E-47
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 808 1356 1.0E-47
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 103 665 1.0E-47
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 97 665 1.0E-47
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 42 659 1.0E-47
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 188 665 2.0E-47
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 213 666 2.0E-47
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 795 1356 2.0E-47
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 795 1356 3.0E-47
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 791 1363 3.0E-47
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 128 665 4.0E-47
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 791 1363 4.0E-47
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 791 1363 5.0E-47
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 116 665 6.0E-47
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 97 666 6.0E-47
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 370 665 6.0E-47
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 791 1363 6.0E-47
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 353 665 7.0E-47
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 791 1363 7.0E-47
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 791 1363 7.0E-47
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 141 653 8.0E-47
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 791 1363 8.0E-47
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 791 1363 9.0E-47
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 795 1363 9.0E-47
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 116 665 1.0E-46
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 116 661 1.0E-46
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 116 661 1.0E-46
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 117 665 1.0E-46
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 312 665 1.0E-46
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 110 661 1.0E-46
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 795 1356 2.0E-46
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 795 1356 2.0E-46
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 795 1356 2.0E-46
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 795 1356 2.0E-46
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 787 1356 2.0E-46
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 787 1356 2.0E-46
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 787 1356 2.0E-46
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 1013 1356 2.0E-46
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 318 665 2.0E-46
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 127 672 2.0E-46
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 766 1356 2.0E-46
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 766 1356 2.0E-46
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 128 665 2.0E-46
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 34 665 2.0E-46
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 791 1363 2.0E-46
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 791 1363 2.0E-46
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 731 1356 2.0E-46
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 791 1350 2.0E-46
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 116 665 2.0E-46
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 116 665 3.0E-46
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 795 1356 3.0E-46
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 795 1356 3.0E-46
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 795 1356 3.0E-46
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 795 1356 3.0E-46
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 179 676 3.0E-46
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 70 671 3.0E-46
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 795 1356 3.0E-46
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 915 1357 3.0E-46
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 383 665 4.0E-46
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 731 1356 4.0E-46
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 141 666 4.0E-46
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 141 666 4.0E-46
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 132 666 4.0E-46
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 788 1358 5.0E-46
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 1092 1356 5.0E-46
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 795 1356 5.0E-46
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 179 676 5.0E-46
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 382 667 5.0E-46
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 382 667 5.0E-46
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 382 667 5.0E-46
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 382 667 5.0E-46
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 382 667 5.0E-46
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 382 667 5.0E-46
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 382 667 5.0E-46
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 382 667 5.0E-46
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 382 667 5.0E-46
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 234 665 6.0E-46
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 1003 1356 7.0E-46
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 1003 1356 7.0E-46
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 1003 1356 7.0E-46
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 366 665 9.0E-46
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 733 1356 1.0E-45
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 126 652 1.0E-45
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 116 665 1.0E-45
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 316 665 1.0E-45
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 116 661 1.0E-45
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 116 661 1.0E-45
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 1079 1356 1.0E-45
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 51 665 1.0E-45
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 51 665 1.0E-45
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 806 1356 1.0E-45
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 207 1356 2.0E-45
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 51 665 2.0E-45
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 200 1356 2.0E-45
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 199 670 2.0E-45
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 731 1356 2.0E-45
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 1084 1358 3.0E-45
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 715 1363 3.0E-45
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 799 1350 3.0E-45
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 799 1351 3.0E-45
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 799 1351 3.0E-45
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 799 1350 3.0E-45
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 799 1351 4.0E-45
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 845 1356 4.0E-45
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 70 676 4.0E-45
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 70 671 5.0E-45
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 807 1357 5.0E-45
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 799 1351 6.0E-45
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 34 665 6.0E-45
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 1074 1358 7.0E-45
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 850 1355 8.0E-45
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 795 1356 1.0E-44
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 117 673 2.0E-44
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 49 656 2.0E-44
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 130 674 2.0E-44
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 116 661 2.0E-44
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 114 665 2.0E-44
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 124 672 2.0E-44
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 353 665 2.0E-44
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 221 664 3.0E-44
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 790 1365 3.0E-44
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 403 1351 3.0E-44
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 806 1356 4.0E-44
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 403 1351 4.0E-44
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 806 1356 4.0E-44
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 795 1356 5.0E-44
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 188 656 5.0E-44
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 397 1340 5.0E-44
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 100 667 5.0E-44
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 791 1351 6.0E-44
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 200 1356 6.0E-44
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 116 661 6.0E-44
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 34 665 8.0E-44
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 109 665 8.0E-44
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 1092 1356 1.0E-43
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 49 665 1.0E-43
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 795 1356 1.0E-43
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 116 665 1.0E-43
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 790 1356 2.0E-43
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 798 1356 2.0E-43
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 795 1358 2.0E-43
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 879 1357 2.0E-43
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 769 1365 2.0E-43
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 353 665 2.0E-43
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 915 1358 2.0E-43
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 381 672 2.0E-43
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 1089 1364 3.0E-43
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 791 1356 3.0E-43
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 239 665 3.0E-43
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 130 674 3.0E-43
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 337 678 4.0E-43
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 88 665 4.0E-43
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 790 1356 4.0E-43
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 732 1356 5.0E-43
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 759 1356 5.0E-43
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 915 1358 5.0E-43
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 1082 1354 5.0E-43
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 1082 1354 5.0E-43
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 179 670 5.0E-43
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 377 663 6.0E-43
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 221 664 6.0E-43
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 239 665 7.0E-43
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 239 665 7.0E-43
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 239 665 7.0E-43
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 70 683 7.0E-43
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 337 678 7.0E-43
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 807 1357 8.0E-43
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 117 665 8.0E-43
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 1090 1356 9.0E-43
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 783 1357 1.0E-42
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 808 1357 1.0E-42
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 1013 1356 1.0E-42
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 715 1363 1.0E-42
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 367 661 1.0E-42
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 794 1356 1.0E-42
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 221 664 1.0E-42
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 397 1340 1.0E-42
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 130 653 1.0E-42
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 188 652 1.0E-42
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 367 663 1.0E-42
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 795 1357 2.0E-42
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 231 1354 2.0E-42
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 886 1352 2.0E-42
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 791 1356 2.0E-42
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 793 1356 2.0E-42
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 117 674 2.0E-42
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 234 656 2.0E-42
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 234 656 2.0E-42
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 88 665 2.0E-42
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 88 665 2.0E-42
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 128 1366 3.0E-42
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 818 1358 3.0E-42
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 372 661 3.0E-42
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 759 1356 3.0E-42
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 845 1356 4.0E-42
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 845 1356 4.0E-42
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 845 1356 4.0E-42
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 808 1357 4.0E-42
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 1092 1356 4.0E-42
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 753 1356 4.0E-42
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 759 1356 5.0E-42
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 70 677 6.0E-42
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 200 680 6.0E-42
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 1095 1358 6.0E-42
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 117 652 7.0E-42
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 48 664 7.0E-42
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 810 1356 1.0E-41
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 153 665 2.0E-41
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 126 665 2.0E-41
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 845 1356 2.0E-41
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 800 1356 2.0E-41
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 800 1356 2.0E-41
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 845 1356 2.0E-41
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 806 1362 2.0E-41
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 704 1356 2.0E-41
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 750 1358 3.0E-41
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 800 1356 3.0E-41
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 800 1356 3.0E-41
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 845 1356 4.0E-41
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 1065 1356 4.0E-41
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 1095 1365 4.0E-41
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 114 664 5.0E-41
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 114 664 5.0E-41
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 114 664 5.0E-41
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 800 1356 5.0E-41
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 800 1356 5.0E-41
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 806 1362 5.0E-41
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 326 671 6.0E-41
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 1095 1366 6.0E-41
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 734 1356 6.0E-41
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 750 1358 7.0E-41
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 378 679 7.0E-41
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 126 665 7.0E-41
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 769 1357 7.0E-41
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 71 649 9.0E-41
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 806 1356 1.0E-40
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 700 1337 1.0E-40
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 380 1340 1.0E-40
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1078 1366 1.0E-40
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 796 1356 1.0E-40
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 1089 1356 1.0E-40
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 783 1357 1.0E-40
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 806 1356 1.0E-40
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 750 1358 2.0E-40
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 750 1358 2.0E-40
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 199 665 2.0E-40
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 806 1362 3.0E-40
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 102 661 3.0E-40
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 112 664 3.0E-40
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 141 639 5.0E-40
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 378 674 5.0E-40
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 381 665 5.0E-40
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 802 1356 5.0E-40
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 795 1356 5.0E-40
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 1095 1358 6.0E-40
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 823 1357 6.0E-40
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 806 1356 7.0E-40
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 788 1356 9.0E-40
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 788 1356 9.0E-40
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 788 1356 9.0E-40
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 915 1360 1.0E-39
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 26 672 1.0E-39
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 789 1351 1.0E-39
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 129 666 2.0E-39
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 1083 1356 2.0E-39
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 1083 1356 2.0E-39
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 1083 1356 2.0E-39
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 1058 1356 2.0E-39
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 802 1356 2.0E-39
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 806 1356 2.0E-39
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 402 1364 3.0E-39
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 129 665 3.0E-39
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 129 665 3.0E-39
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 129 665 3.0E-39
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 1097 1356 3.0E-39
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 71 649 3.0E-39
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 1095 1356 3.0E-39
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 818 1356 4.0E-39
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 787 1356 5.0E-39
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 738 1342 6.0E-39
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 795 1356 6.0E-39
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 810 1357 7.0E-39
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 811 1356 7.0E-39
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 795 1356 8.0E-39
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 792 1357 9.0E-39
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 845 1356 9.0E-39
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 845 1356 9.0E-39
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 350 663 1.0E-38
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 788 1364 2.0E-38
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 733 1350 2.0E-38
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 385 1356 2.0E-38
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 381 665 2.0E-38
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 95 667 2.0E-38
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 1095 1366 2.0E-38
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 124 664 3.0E-38
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 845 1356 3.0E-38
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 845 1356 3.0E-38
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 787 1356 4.0E-38
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 1094 1356 5.0E-38
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 1095 1351 5.0E-38
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 1089 1356 5.0E-38
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 70 667 5.0E-38
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 866 1365 6.0E-38
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 738 1340 6.0E-38
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 866 1365 7.0E-38
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 866 1365 7.0E-38
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 808 1342 8.0E-38
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 1079 1364 8.0E-38
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 51 665 9.0E-38
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 927 1365 9.0E-38
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 1095 1356 1.0E-37
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 1094 1356 1.0E-37
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 1095 1357 1.0E-37
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 385 1352 1.0E-37
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 124 664 1.0E-37
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 800 1356 1.0E-37
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 126 661 1.0E-37
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 109 680 2.0E-37
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 1089 1356 2.0E-37
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 1089 1356 2.0E-37
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 149 665 2.0E-37
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 126 661 2.0E-37
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 130 652 3.0E-37
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 1094 1358 4.0E-37
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 109 680 5.0E-37
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 1094 1356 7.0E-37
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 1094 1356 7.0E-37
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 378 672 7.0E-37
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 378 672 7.0E-37
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 795 1340 9.0E-37
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 109 680 1.0E-36
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 109 680 1.0E-36
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 378 673 1.0E-36
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 359 661 1.0E-36
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 1095 1356 1.0E-36
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 1094 1356 1.0E-36
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 1094 1356 1.0E-36
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 378 661 2.0E-36
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 1089 1356 3.0E-36
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 1085 1352 4.0E-36
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 102 665 5.0E-36
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 800 1356 6.0E-36
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 1095 1350 7.0E-36
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 231 1351 8.0E-36
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 325 672 1.0E-35
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 1065 1366 1.0E-35
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 1095 1363 2.0E-35
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 378 665 3.0E-35
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 384 639 3.0E-35
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 882 1350 5.0E-35
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 1095 1356 6.0E-35
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 1093 1357 1.0E-34
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 385 1352 2.0E-34
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 124 667 2.0E-34
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 1102 1365 2.0E-34
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 400 1362 2.0E-34
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 1095 1356 2.0E-34
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 1089 1356 2.0E-34
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 1087 1356 2.0E-34
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 123 664 4.0E-34
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 923 1364 4.0E-34
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 131 663 5.0E-34
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 124 664 7.0E-34
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 131 663 8.0E-34
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 374 1350 9.0E-34
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 799 1356 9.0E-34
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 799 1356 1.0E-33
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 344 667 2.0E-33
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 344 667 2.0E-33
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 344 667 2.0E-33
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 123 664 2.0E-33
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 789 1356 4.0E-33
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 789 1356 4.0E-33
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 789 1356 4.0E-33
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 819 1356 4.0E-33
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 50 663 5.0E-33
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 131 667 8.0E-33
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 797 1365 1.0E-32
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 847 1356 1.0E-32
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 219 680 1.0E-32
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 817 1340 3.0E-32
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 138 674 3.0E-32
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 806 1356 4.0E-32
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 548 1351 4.0E-32
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 403 1352 4.0E-32
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 131 663 4.0E-32
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 219 680 4.0E-32
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 124 661 5.0E-32
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 383 666 8.0E-32
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 131 663 2.0E-31
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 131 663 2.0E-31
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 131 663 4.0E-31
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 367 665 5.0E-31
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 78 661 6.0E-31
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 322 665 8.0E-31
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 322 665 8.0E-31
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 322 665 8.0E-31
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 1095 1356 1.0E-30
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 847 1358 1.0E-30
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 1095 1364 1.0E-30
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 1102 1365 1.0E-30
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 1095 1356 2.0E-30
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 1094 1356 2.0E-30
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 1094 1356 2.0E-30
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 1099 1340 2.0E-30
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 204 1340 2.0E-30
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 403 1342 3.0E-30
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 353 639 5.0E-30
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 847 1356 7.0E-30
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 1095 1356 1.0E-29
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 1093 1357 1.0E-29
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 1094 1356 1.0E-29
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 100 675 2.0E-29
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 847 1357 2.0E-29
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 122 652 3.0E-29
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 117 667 3.0E-29
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 737 1350 4.0E-29
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 1095 1356 4.0E-29
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 1095 1356 4.0E-29
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 1095 1356 4.0E-29
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 847 1356 1.0E-28
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 847 1356 1.0E-28
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 390 661 2.0E-28
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 390 661 2.0E-28
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 390 661 2.0E-28
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 140 663 2.0E-28
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 403 1357 2.0E-28
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 1094 1356 4.0E-28
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 100 674 4.0E-28
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 354 658 5.0E-28
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 383 642 5.0E-28
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 5 663 7.0E-28
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 101 661 7.0E-28
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 101 661 7.0E-28
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 28 644 1.0E-27
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 385 658 1.0E-27
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 63 660 1.0E-27
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 105 689 2.0E-27
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 785 1356 2.0E-27
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 140 663 2.0E-27
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 1086 1356 2.0E-27
sp|P75095|Y018_MYCPN Putative ABC transporter ATP-binding protein MG014 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_018 PE=3 SV=1 359 665 2.0E-27
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 383 642 2.0E-27
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 56 660 3.0E-27
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 90 664 5.0E-27
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 101 661 6.0E-27
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 1085 1342 9.0E-27
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 131 667 1.0E-26
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1095 1350 1.0E-26
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 402 644 1.0E-26
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 383 667 1.0E-26
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 109 658 1.0E-26
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 383 642 2.0E-26
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 1085 1342 2.0E-26
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 132 652 2.0E-26
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 115 667 2.0E-26
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 67 666 3.0E-26
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 90 664 3.0E-26
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1095 1356 3.0E-26
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 383 667 3.0E-26
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 90 664 4.0E-26
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 1093 1332 4.0E-26
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 138 667 4.0E-26
sp|Q24QI5|METN_DESHY Methionine import ATP-binding protein MetN OS=Desulfitobacterium hafniense (strain Y51) GN=metN PE=3 SV=1 385 670 5.0E-26
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 359 665 6.0E-26
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 1095 1350 7.0E-26
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 131 663 8.0E-26
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 383 639 8.0E-26
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 382 665 8.0E-26
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 1095 1350 9.0E-26
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 382 665 1.0E-25
sp|Q52402|AARD_PROST Transport ATP-binding protein AarD OS=Providencia stuartii GN=aarD PE=3 SV=1 406 662 1.0E-25
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 387 652 1.0E-25
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 1050 1356 1.0E-25
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 79 664 2.0E-25
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 382 665 2.0E-25
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1081 1342 2.0E-25
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 376 672 4.0E-25
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 910 1357 4.0E-25
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 382 665 4.0E-25
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 122 667 4.0E-25
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 383 656 5.0E-25
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1073 1356 6.0E-25
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 131 663 7.0E-25
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 1090 1332 8.0E-25
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 383 661 9.0E-25
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 376 666 1.0E-24
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 141 664 1.0E-24
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 366 675 1.0E-24
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 384 665 1.0E-24
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 32 664 1.0E-24
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 382 672 2.0E-24
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1082 1356 2.0E-24
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 383 639 3.0E-24
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 148 666 3.0E-24
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 383 639 4.0E-24
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 1095 1351 4.0E-24
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 382 662 5.0E-24
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 1060 1356 5.0E-24
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 385 701 6.0E-24
sp|Q65P77|ECFA1_BACLD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ecfA1 PE=3 SV=1 382 658 7.0E-24
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 385 651 8.0E-24
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 422 665 1.0E-23
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 140 663 1.0E-23
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 382 644 1.0E-23
sp|Q1WSB8|ECFA1_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA1 PE=3 SV=1 385 665 1.0E-23
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 1095 1364 1.0E-23
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 385 651 2.0E-23
sp|Q49W48|METN_STAS1 Methionine import ATP-binding protein MetN OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metN PE=3 SV=1 385 646 2.0E-23
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 1098 1344 2.0E-23
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 380 667 2.0E-23
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1095 1356 2.0E-23
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 1094 1366 2.0E-23
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 131 706 2.0E-23
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 89 655 3.0E-23
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 1107 1350 3.0E-23
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 1067 1351 3.0E-23
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 1095 1342 4.0E-23
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 381 663 4.0E-23
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 114 716 5.0E-23
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 1095 1364 6.0E-23
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 117 667 6.0E-23
sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 384 651 6.0E-23
sp|Q6HP89|METN1_BACHK Methionine import ATP-binding protein MetN 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN1 PE=3 SV=1 385 649 7.0E-23
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 382 653 7.0E-23
sp|Q81ZF5|METN2_BACAN Methionine import ATP-binding protein MetN 2 OS=Bacillus anthracis GN=metN2 PE=3 SV=1 385 649 8.0E-23
sp|Q6AE21|METN_LEIXX Methionine import ATP-binding protein MetN OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metN PE=3 SV=1 385 653 9.0E-23
sp|Q81IN8|METN2_BACCR Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN2 PE=3 SV=1 385 649 9.0E-23
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 1069 1340 1.0E-22
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 385 651 1.0E-22
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 322 674 1.0E-22
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 140 640 1.0E-22
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1085 1342 2.0E-22
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 1059 1357 2.0E-22
sp|Q39IE7|METN1_BURL3 Methionine import ATP-binding protein MetN 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN1 PE=3 SV=1 385 646 2.0E-22
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 406 662 2.0E-22
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 1092 1363 3.0E-22
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 403 653 3.0E-22
sp|Q63S19|METN1_BURPS Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain K96243) GN=metN1 PE=3 SV=1 385 647 3.0E-22
sp|Q3JPZ4|METN1_BURP1 Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain 1710b) GN=metN1 PE=3 SV=1 385 647 3.0E-22
sp|Q62M41|METN1_BURMA Methionine import ATP-binding protein MetN 1 OS=Burkholderia mallei (strain ATCC 23344) GN=metN1 PE=3 SV=1 385 647 3.0E-22
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 364 653 3.0E-22
sp|Q63GR8|METN2_BACCZ Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ZK / E33L) GN=metN2 PE=3 SV=1 385 649 3.0E-22
sp|Q7A7E3|METN1_STAAN Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain N315) GN=metN1 PE=3 SV=1 385 653 3.0E-22
sp|Q99WE1|METN1_STAAM Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN1 PE=3 SV=1 385 653 3.0E-22
sp|A0K5N5|METN1_BURCH Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain HI2424) GN=metN1 PE=3 SV=2 385 646 3.0E-22
sp|Q1BY14|METN1_BURCA Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN1 PE=3 SV=2 385 646 3.0E-22
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1094 1352 3.0E-22
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 370 653 4.0E-22
sp|Q2SY12|METN_BURTA Methionine import ATP-binding protein MetN OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metN PE=3 SV=1 385 647 4.0E-22
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 391 652 4.0E-22
sp|Q830W6|POTA_ENTFA Spermidine/putrescine import ATP-binding protein PotA OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=potA PE=3 SV=1 1095 1345 5.0E-22
sp|Q73EL7|METN2_BACC1 Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN2 PE=3 SV=1 385 649 5.0E-22
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 394 670 5.0E-22
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 394 670 6.0E-22
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 155 652 8.0E-22
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 384 652 8.0E-22
sp|Q0BH79|METN1_BURCM Methionine import ATP-binding protein MetN 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN1 PE=3 SV=1 385 646 8.0E-22
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 141 655 8.0E-22
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 105 664 9.0E-22
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 385 646 9.0E-22
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 136 634 1.0E-21
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 1107 1342 1.0E-21
sp|Q6GEL3|ECFA1_STAAR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA1 PE=3 SV=1 385 653 1.0E-21
sp|P40735|ECFA1_BACSU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus subtilis (strain 168) GN=ecfA PE=3 SV=3 385 661 1.0E-21
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 385 670 1.0E-21
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 385 647 1.0E-21
sp|Q13VD7|METN1_BURXL Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1 385 647 1.0E-21
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 384 653 1.0E-21
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 1094 1344 1.0E-21
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 141 655 1.0E-21
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 1094 1352 1.0E-21
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1095 1350 2.0E-21
sp|Q7NZI7|PSTB_CHRVO Phosphate import ATP-binding protein PstB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pstB PE=3 SV=1 377 652 2.0E-21
sp|Q1WVI7|POTA_LACS1 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus salivarius (strain UCC118) GN=potA PE=3 SV=1 1095 1345 2.0E-21
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 383 657 2.0E-21
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 385 651 2.0E-21
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 1108 1340 3.0E-21
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 399 639 3.0E-21
sp|Q6A6X6|METN_PROAC Methionine import ATP-binding protein MetN OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=metN PE=3 SV=1 390 647 4.0E-21
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 1095 1344 5.0E-21
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 403 720 6.0E-21
sp|Q7M816|METN_WOLSU Methionine import ATP-binding protein MetN OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=metN PE=3 SV=1 402 652 6.0E-21
sp|Q67SV5|METN_SYMTH Methionine import ATP-binding protein MetN OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metN PE=3 SV=1 398 656 6.0E-21
sp|Q9KTJ5|METN_VIBCH Methionine import ATP-binding protein MetN OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metN PE=3 SV=1 385 670 6.0E-21
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 385 654 7.0E-21
sp|Q032A0|METN_LACLS Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=metN PE=3 SV=1 378 647 8.0E-21
sp|Q5WJP0|METN2_BACSK Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1 385 649 8.0E-21
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 1095 1364 9.0E-21
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 1113 1345 9.0E-21
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 1087 1352 9.0E-21
sp|D8KFN1|METN_LACLN Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. cremoris (strain NZ9000) GN=metN PE=3 SV=1 378 647 9.0E-21
sp|P0CI33|METN_LACLM Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metN PE=3 SV=1 378 647 9.0E-21
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1069 1342 1.0E-20
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 1095 1350 1.0E-20
sp|P14175|PROV_ECOLI Glycine betaine/L-proline transport ATP-binding protein ProV OS=Escherichia coli (strain K12) GN=proV PE=1 SV=1 407 653 1.0E-20
sp|Q03P57|METN_LACBA Methionine import ATP-binding protein MetN OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=metN PE=3 SV=1 382 646 1.0E-20
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 1095 1345 1.0E-20
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 1095 1345 1.0E-20
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 1095 1345 1.0E-20
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 1095 1345 1.0E-20
sp|Q9CIN4|METN_LACLA Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metN PE=3 SV=1 378 647 1.0E-20
sp|Q7VI92|METN_HELHP Methionine import ATP-binding protein MetN OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=metN PE=3 SV=1 385 651 1.0E-20
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 1095 1340 2.0E-20
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 1111 1352 2.0E-20
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 200 666 2.0E-20
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 384 653 2.0E-20
sp|Q1QSE9|PSTB2_CHRSD Phosphate import ATP-binding protein PstB 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pstB2 PE=3 SV=1 403 652 2.0E-20
sp|Q18K56|PSTB_HALWD Phosphate import ATP-binding protein PstB OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pstB PE=3 SV=1 384 652 2.0E-20
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 1095 1345 2.0E-20
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 1095 1345 2.0E-20
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 1095 1345 2.0E-20
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 1095 1345 2.0E-20
sp|Q2KDV1|PHNC_RHIEC Phosphonates import ATP-binding protein PhnC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=phnC PE=3 SV=1 386 651 2.0E-20
sp|Q5E715|METN_VIBF1 Methionine import ATP-binding protein MetN OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=metN PE=3 SV=2 394 672 2.0E-20
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1077 1349 3.0E-20
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 225 675 3.0E-20
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 1113 1339 3.0E-20
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 385 652 3.0E-20
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1062 1350 3.0E-20
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 1095 1345 3.0E-20
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 1095 1345 3.0E-20
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 1095 1345 3.0E-20
sp|P17328|PROV_SALTY Glycine betaine/L-proline transport ATP-binding protein ProV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proV PE=3 SV=2 407 653 3.0E-20
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 800 1357 4.0E-20
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 1092 1345 4.0E-20
sp|Q1WSB8|ECFA1_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA1 PE=3 SV=1 1092 1344 5.0E-20
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 1096 1350 5.0E-20
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 1096 1350 5.0E-20
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 1095 1352 6.0E-20
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 394 653 7.0E-20
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 383 664 7.0E-20
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 967 1356 8.0E-20
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 371 641 8.0E-20
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 1111 1350 1.0E-19
sp|Q65P77|ECFA1_BACLD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ecfA1 PE=3 SV=1 1095 1349 1.0E-19
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 1082 1345 1.0E-19
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1096 1350 1.0E-19
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 1094 1354 1.0E-19
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 1111 1352 2.0E-19
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 1095 1340 2.0E-19
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 1095 1340 2.0E-19
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 825 1350 2.0E-19
sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 1112 1349 2.0E-19
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 141 634 2.0E-19
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 382 642 3.0E-19
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 1111 1350 4.0E-19
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 387 670 4.0E-19
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 385 646 4.0E-19
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 1113 1352 5.0E-19
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 1073 1356 5.0E-19
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 1083 1356 8.0E-19
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 384 686 1.0E-18
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 1104 1352 2.0E-18
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 1104 1352 2.0E-18
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 1112 1349 2.0E-18
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 1102 1352 2.0E-18
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 1095 1350 3.0E-18
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 1095 1349 3.0E-18
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 1102 1356 3.0E-18
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 403 832 5.0E-18
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 1084 1360 5.0E-18
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 1095 1349 5.0E-18
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 825 1360 6.0E-18
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 1095 1352 8.0E-18
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1094 1360 9.0E-18
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 1092 1345 1.0E-17
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 384 676 1.0E-17
sp|Q2KDV1|PHNC_RHIEC Phosphonates import ATP-binding protein PhnC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=phnC PE=3 SV=1 1116 1355 1.0E-17
sp|Q52402|AARD_PROST Transport ATP-binding protein AarD OS=Providencia stuartii GN=aarD PE=3 SV=1 1116 1364 2.0E-17
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 400 673 2.0E-17
sp|Q6GEL3|ECFA1_STAAR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA1 PE=3 SV=1 1095 1349 2.0E-17
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 1113 1345 2.0E-17
sp|Q67SV5|METN_SYMTH Methionine import ATP-binding protein MetN OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metN PE=3 SV=1 1113 1364 2.0E-17
sp|Q24QI5|METN_DESHY Methionine import ATP-binding protein MetN OS=Desulfitobacterium hafniense (strain Y51) GN=metN PE=3 SV=1 1095 1326 2.0E-17
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 1132 1363 3.0E-17
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 1114 1349 3.0E-17
sp|Q7A7E3|METN1_STAAN Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain N315) GN=metN1 PE=3 SV=1 1095 1351 3.0E-17
sp|Q99WE1|METN1_STAAM Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN1 PE=3 SV=1 1095 1351 3.0E-17
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 1113 1352 3.0E-17
sp|Q5WJP0|METN2_BACSK Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1 1115 1344 3.0E-17
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 403 678 4.0E-17
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1092 1362 4.0E-17
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 1076 1352 4.0E-17
sp|Q6HP89|METN1_BACHK Methionine import ATP-binding protein MetN 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN1 PE=3 SV=1 1095 1344 6.0E-17
sp|Q7VI92|METN_HELHP Methionine import ATP-binding protein MetN OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=metN PE=3 SV=1 1095 1351 6.0E-17
sp|Q81ZF5|METN2_BACAN Methionine import ATP-binding protein MetN 2 OS=Bacillus anthracis GN=metN2 PE=3 SV=1 1095 1344 7.0E-17
sp|Q81IN8|METN2_BACCR Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN2 PE=3 SV=1 1095 1344 7.0E-17
sp|P40735|ECFA1_BACSU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus subtilis (strain 168) GN=ecfA PE=3 SV=3 1095 1349 7.0E-17
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1111 1363 8.0E-17
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 178 677 9.0E-17
sp|Q63GR8|METN2_BACCZ Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ZK / E33L) GN=metN2 PE=3 SV=1 1095 1344 9.0E-17
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 1095 1344 1.0E-16
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 185 665 1.0E-16
sp|Q73EL7|METN2_BACC1 Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN2 PE=3 SV=1 1095 1344 1.0E-16
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 1113 1351 1.0E-16
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 1095 1352 1.0E-16
sp|Q6AE21|METN_LEIXX Methionine import ATP-binding protein MetN OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metN PE=3 SV=1 1095 1345 2.0E-16
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 803 1354 2.0E-16
sp|Q49W48|METN_STAS1 Methionine import ATP-binding protein MetN OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metN PE=3 SV=1 1107 1344 4.0E-16
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 1112 1349 5.0E-16
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 1094 1356 9.0E-16
sp|P17328|PROV_SALTY Glycine betaine/L-proline transport ATP-binding protein ProV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proV PE=3 SV=2 1113 1350 9.0E-16
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 1094 1356 1.0E-15
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 1112 1349 1.0E-15
sp|Q2SY12|METN_BURTA Methionine import ATP-binding protein MetN OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metN PE=3 SV=1 1113 1345 1.0E-15
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 1095 1344 1.0E-15
sp|Q7NZI7|PSTB_CHRVO Phosphate import ATP-binding protein PstB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pstB PE=3 SV=1 1113 1324 1.0E-15
sp|Q6A6X6|METN_PROAC Methionine import ATP-binding protein MetN OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=metN PE=3 SV=1 1078 1345 1.0E-15
sp|Q9KTJ5|METN_VIBCH Methionine import ATP-binding protein MetN OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metN PE=3 SV=1 1113 1352 1.0E-15
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 1112 1349 2.0E-15
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 1089 1354 2.0E-15
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 403 710 2.0E-15
sp|P14175|PROV_ECOLI Glycine betaine/L-proline transport ATP-binding protein ProV OS=Escherichia coli (strain K12) GN=proV PE=1 SV=1 1113 1350 3.0E-15
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 1112 1356 3.0E-15
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 1108 1345 4.0E-15
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1083 1358 4.0E-15
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 55 725 4.0E-15
sp|Q13VD7|METN1_BURXL Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1 1113 1344 5.0E-15
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1112 1356 5.0E-15
sp|Q03P57|METN_LACBA Methionine import ATP-binding protein MetN OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=metN PE=3 SV=1 1113 1344 5.0E-15
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 826 1356 6.0E-15
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 1094 1356 8.0E-15
sp|Q63S19|METN1_BURPS Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain K96243) GN=metN1 PE=3 SV=1 1113 1345 9.0E-15
sp|Q3JPZ4|METN1_BURP1 Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain 1710b) GN=metN1 PE=3 SV=1 1113 1345 9.0E-15
sp|Q62M41|METN1_BURMA Methionine import ATP-binding protein MetN 1 OS=Burkholderia mallei (strain ATCC 23344) GN=metN1 PE=3 SV=1 1113 1345 9.0E-15
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 1108 1345 9.0E-15
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 403 680 1.0E-14
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 385 675 1.0E-14
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 385 708 1.0E-14
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 1055 1350 1.0E-14
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 367 682 2.0E-14
sp|Q39IE7|METN1_BURL3 Methionine import ATP-binding protein MetN 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN1 PE=3 SV=1 1113 1344 2.0E-14
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 1077 1364 2.0E-14
sp|P75095|Y018_MYCPN Putative ABC transporter ATP-binding protein MG014 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_018 PE=3 SV=1 1060 1356 2.0E-14
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 402 728 2.0E-14
sp|Q5E715|METN_VIBF1 Methionine import ATP-binding protein MetN OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=metN PE=3 SV=2 1104 1352 2.0E-14
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1083 1358 3.0E-14
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 367 682 3.0E-14
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 400 706 3.0E-14
sp|Q1QSE9|PSTB2_CHRSD Phosphate import ATP-binding protein PstB 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pstB2 PE=3 SV=1 1090 1342 3.0E-14
sp|A0K5N5|METN1_BURCH Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain HI2424) GN=metN1 PE=3 SV=2 1113 1344 4.0E-14
sp|Q1BY14|METN1_BURCA Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN1 PE=3 SV=2 1113 1344 4.0E-14
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1081 1352 4.0E-14
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 1073 1345 5.0E-14
sp|Q0BH79|METN1_BURCM Methionine import ATP-binding protein MetN 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN1 PE=3 SV=1 1113 1344 5.0E-14
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 1073 1345 6.0E-14
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 1090 1350 7.0E-14
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 382 666 1.0E-13
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 1113 1345 5.0E-13
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 402 664 5.0E-13
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 1108 1345 8.0E-13
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 1080 1345 1.0E-12
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 403 682 1.0E-12
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 385 703 1.0E-12
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 406 683 1.0E-12
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 201 663 1.0E-12
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 1093 1340 2.0E-12
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 364 653 2.0E-12
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1083 1358 2.0E-12
sp|Q7M816|METN_WOLSU Methionine import ATP-binding protein MetN OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=metN PE=3 SV=1 1112 1349 5.0E-12
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 795 1065 6.0E-12
sp|Q9CIN4|METN_LACLA Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metN PE=3 SV=1 1113 1352 7.0E-12
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 403 704 7.0E-12
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 221 736 8.0E-12
sp|Q1WVI7|POTA_LACS1 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus salivarius (strain UCC118) GN=potA PE=3 SV=1 390 653 9.0E-12
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 385 689 1.0E-11
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 403 682 2.0E-11
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 385 651 2.0E-11
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 207 652 2.0E-11
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 1107 1350 2.0E-11
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 382 639 3.0E-11
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 202 662 4.0E-11
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 1107 1350 6.0E-11
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 843 1352 7.0E-11
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 403 943 9.0E-11
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1112 1344 9.0E-11
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 554 677 1.0E-10
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 1194 1350 1.0E-10
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 554 677 1.0E-10
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 1194 1350 1.0E-10
sp|Q032A0|METN_LACLS Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=metN PE=3 SV=1 1113 1352 1.0E-10
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 548 677 1.0E-10
sp|Q18K56|PSTB_HALWD Phosphate import ATP-binding protein PstB OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pstB PE=3 SV=1 1109 1344 1.0E-10
sp|D8KFN1|METN_LACLN Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. cremoris (strain NZ9000) GN=metN PE=3 SV=1 1113 1352 2.0E-10
sp|P0CI33|METN_LACLM Methionine import ATP-binding protein MetN OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metN PE=3 SV=1 1113 1352 2.0E-10
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 383 646 3.0E-10
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 738 1047 4.0E-10
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1194 1350 5.0E-10
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 825 1350 8.0E-10
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 551 662 8.0E-10
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 1112 1349 3.0E-09
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 850 1364 3.0E-09
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 544 721 4.0E-09
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 544 721 4.0E-09
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 1113 1356 4.0E-09
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 1113 1356 5.0E-09
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 1113 1356 8.0E-09
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1113 1352 2.0E-08
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 557 665 5.0E-08
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 1185 1364 1.0E-07
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 1185 1364 2.0E-07
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 740 1065 2.0E-07
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 1185 1364 2.0E-07
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 534 654 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 27 46 19
2 51 73 22
3 103 125 22
4 176 195 19
5 200 222 22
6 278 300 22
7 796 818 22
8 869 891 22
9 895 917 22
10 975 997 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9221
MGSGEKDASGRDGGATANADDGGSKKPLAAALGYLGLLTAAGPAALDYALLVVGVLASIAAGVPFPIMSLLFGQL
LDQLSEASCSSKPPSASYHAALSQKVLLTVYVTFANFALIYLSTGAWSLFGERLVRRLRYGYLCALLRQEIAFFE
TLETGHVAARLDSDLLTIQTGVSEKVGIVIQSVSYFAVAYIVAFIKAPKLAGMLFSLVPAYFIMAFIGTHLSGKY
RAVVEKRMDRATSLASESLANIKLIKAFHAGKRIQLIFDDYLAATRRPGIIRLVTAAIQMGLLYFIAFSANALAF
SQGGKQVAEARQKGDSNLTLGAVYTVMVSLIDASYIISQIAPFLNMFAAASQTAEKILITMSRKPTIDSSPEARG
LVMAAIEGRVELRDVSFRYPSRQETVILDKLNLTIPAGKMTGIVGLSGSGKSTVASLIQRFYDPTEGSIFVDGHD
VRELNLQSLRGHIGYVEQSPVLFNRSILENIAHGLVSSSRPEHWDLRPLLVSGEVADLAEAVRNGGDADQLAGPS
SEMARLLSLVRVAAGQAGLDAFLDKFPQGLATSVGPGGNRLSGGQKQRVALARTLIRNPSILILDEATASLDSTT
EIQIRDAIEGLAGQRTVICIAHRLSTVKNAHTIVVMRAGGQIAEQGSYDELMNLDGDFASMVRSQAIPRDEKDSD
TIVAESLGDSGPHGDMLLEKAAFARDGDVSEKPRPGDEGETGNATNSQAFDANRGFLSTFVLILKMARPQLLLIV
TGFLSSIVVGGARSGEAVIFGNAVEQLSVCRSTSQMRSSASLYGLLFFALAVVEFFANALSAACFGWVSDELVRR
LRSLAMRSLLRREVRWHESDGRTPGNLLSYVSADAAAMSGLTGTILGVSVSVVVMLVAAVVLAHVVAWKVALVLT
ACIPLIFGSGFLRLRLLAQFAERHAKAFAESVSTATESVTHIRTVSALALQDEVASTFGRALRGPYQATLRSIAF
GNAWLATAFSVGSLVKALAFWWGGRLIAQGEMTQSAFFIALVSLLTAAHSSGQLFSLSPDVTKAAVAARRVFGLI
CADGRIDRLRAKEADGQGDVEKRAAAETLQAAPRCSESRAAGMSVSFESVSFSYPSRPDAPILRDVSLDIPPGSF
VALVGTSGAGKSTVLSLLQRLYRPASGTIRLDGYDITRRIPDRTGEKEQTADEEEEVEEDDLPIWDDVALVPQDA
TLFSGSVAFNIGLGGRGTREATPAEIEEAARLANIHETIRALPQGYETLCGPTGSQFFSGGQKQRLCIARALLRR
PRLLLLDEPSSAMDAESEALWERSLESIMGAGSGGRRRVTVVGIAHRLRTIMKADRIFVMEGGRVLDAGTHGELV
ARCGKYRDDVMHQSLG*
Coding >Hirsu2|9221
ATGGGCTCTGGCGAGAAAGACGCATCTGGCCGAGATGGCGGCGCCACCGCCAACGCCGATGACGGCGGCAGCAAG
AAGCCCCTTGCCGCTGCTCTCGGCTATCTTGGCCTCCTGACGGCCGCCGGCCCCGCGGCGCTGGACTACGCCCTG
CTCGTCGTCGGCGTCCTCGCCTCCATTGCTGCCGGCGTGCCCTTCCCCATCATGTCTCTTCTCTTCGGCCAGCTG
CTCGACCAGTTGAGCGAGGCGTCGTGCTCGAGCAAGCCCCCCTCTGCCTCGTACCACGCCGCTCTGTCGCAAAAG
GTTCTCCTGACCGTCTACGTCACCTTCGCCAACTTCGCCCTCATCTATCTCTCGACCGGCGCCTGGAGCCTGTTC
GGCGAGCGCCTTGTTCGCCGCTTGCGCTACGGCTATCTCTGTGCTCTTCTGCGCCAAGAGATCGCCTTCTTCGAG
ACGCTCGAGACCGGCCATGTGGCCGCACGCCTCGACTCGGATCTGCTCACCATCCAGACGGGCGTCTCCGAAAAG
GTCGGCATCGTCATACAGTCCGTCTCCTACTTCGCCGTCGCCTACATCGTCGCCTTCATCAAGGCCCCCAAGCTG
GCCGGCATGCTCTTCAGCCTCGTGCCCGCCTACTTCATCATGGCCTTCATCGGCACCCACCTCTCCGGCAAGTAC
CGGGCCGTCGTCGAGAAGCGCATGGACCGCGCCACCTCTCTTGCCTCCGAGTCGCTGGCCAACATCAAGCTCATC
AAAGCCTTTCATGCCGGCAAAAGGATTCAGCTCATTTTCGACGACTACCTGGCCGCGACCAGGCGGCCGGGCATC
ATCCGGCTCGTCACGGCAGCGATCCAGATGGGTCTGCTCTACTTCATCGCCTTCTCCGCAAACGCCCTCGCCTTT
TCTCAGGGCGGCAAGCAGGTCGCCGAGGCCAGGCAAAAGGGCGACTCGAACCTCACCCTCGGCGCCGTATACACC
GTCATGGTCTCTCTCATTGACGCGTCGTATATCATCAGCCAGATCGCCCCCTTTCTCAACATGTTCGCCGCCGCC
TCGCAGACGGCCGAAAAGATTTTGATCACTATGAGTCGAAAGCCCACCATCGACTCCTCTCCGGAAGCGCGTGGT
CTGGTAATGGCGGCGATCGAGGGACGTGTCGAGTTGAGGGACGTTTCCTTCCGCTATCCCTCCCGTCAGGAGACG
GTCATCCTGGACAAGCTCAATCTTACCATTCCCGCGGGCAAAATGACGGGCATCGTTGGTCTTTCCGGCAGCGGC
AAATCCACCGTCGCCTCGCTCATTCAGCGCTTCTACGATCCGACTGAGGGTTCCATTTTCGTTGACGGCCACGAC
GTGCGGGAGCTCAACTTGCAGTCCCTGCGCGGCCATATCGGATACGTGGAGCAGAGCCCCGTGCTGTTCAACCGC
TCGATCCTGGAAAACATCGCCCACGGCTTGGTGAGCTCGTCTCGGCCGGAACACTGGGACTTGCGGCCCTTGCTG
GTAAGCGGCGAGGTGGCTGATCTGGCCGAAGCTGTGCGCAATGGTGGCGATGCCGATCAGCTTGCGGGTCCGTCG
AGTGAGATGGCCCGCCTTCTCTCGCTCGTCCGAGTCGCCGCCGGTCAGGCCGGACTGGATGCGTTTCTCGACAAA
TTTCCGCAAGGCCTGGCAACGTCGGTCGGTCCCGGAGGCAATCGCTTGAGTGGCGGACAGAAACAGCGCGTCGCT
CTGGCTCGTACCCTGATCCGAAACCCTTCCATCTTGATACTAGACGAGGCGACTGCGTCTCTCGACTCGACGACC
GAGATCCAGATCCGAGACGCCATCGAGGGCCTGGCGGGGCAACGCACGGTCATATGCATCGCCCATCGCCTCAGC
ACGGTCAAGAACGCGCACACCATCGTCGTCATGCGAGCCGGCGGACAGATTGCAGAGCAGGGAAGCTACGACGAA
TTGATGAACCTCGACGGAGATTTCGCGTCCATGGTCCGCTCTCAGGCTATTCCCCGAGACGAGAAAGATTCGGAT
ACGATCGTAGCCGAGTCTCTTGGCGATTCTGGGCCGCATGGGGACATGTTGCTGGAAAAGGCTGCGTTCGCGCGG
GACGGCGACGTTTCTGAGAAGCCCAGGCCCGGCGACGAGGGAGAGACTGGCAACGCGACGAACTCTCAAGCATTC
GACGCCAACCGAGGCTTCTTGTCGACATTTGTGCTCATTCTCAAGATGGCGCGCCCGCAGCTGCTGCTCATCGTG
ACGGGCTTTCTCTCCTCCATCGTCGTCGGCGGGGCCCGTTCGGGAGAGGCCGTCATCTTCGGCAACGCCGTCGAG
CAGCTGTCCGTCTGTCGCTCGACCTCGCAAATGCGCAGCAGCGCCTCTCTCTATGGGCTCCTCTTCTTCGCCCTG
GCCGTCGTCGAGTTCTTCGCCAACGCGCTCTCCGCCGCGTGCTTCGGCTGGGTCTCGGACGAGCTGGTTCGGAGG
CTGCGCTCGCTCGCGATGCGGTCGCTGCTCAGGCGAGAGGTCCGCTGGCACGAGTCGGACGGCCGGACGCCGGGA
AACTTGCTGTCGTACGTGAGCGCGGATGCCGCGGCCATGAGCGGGCTGACGGGCACCATTCTGGGCGTCTCCGTC
TCCGTCGTCGTCATGCTTGTCGCCGCCGTGGTGCTCGCCCACGTGGTGGCCTGGAAGGTCGCCCTTGTGCTCACG
GCCTGCATCCCCCTCATCTTCGGCTCCGGTTTCCTGCGGCTCCGCCTGCTCGCCCAGTTTGCGGAGCGACACGCC
AAGGCATTCGCCGAGTCGGTCAGCACGGCCACCGAGTCCGTCACCCACATACGCACCGTGTCGGCGCTGGCGCTC
CAGGACGAGGTGGCCAGCACCTTTGGCCGGGCGCTTCGAGGGCCGTATCAGGCCACACTCCGGTCCATCGCCTTC
GGCAACGCATGGCTCGCCACCGCCTTCAGCGTCGGAAGCCTGGTCAAGGCGTTGGCGTTTTGGTGGGGGGGTCGG
CTGATCGCGCAGGGCGAGATGACACAATCCGCCTTCTTCATCGCCCTCGTCTCCCTGCTCACGGCGGCCCACTCG
AGCGGGCAGCTCTTCAGCCTAAGCCCGGACGTGACCAAGGCCGCCGTGGCTGCGCGTCGGGTGTTCGGCCTCATC
TGCGCCGACGGACGCATCGACCGCCTGCGAGCGAAGGAGGCCGACGGACAAGGCGATGTCGAGAAGAGGGCGGCG
GCGGAGACGCTGCAGGCCGCGCCTCGTTGTTCCGAGAGCCGTGCGGCGGGCATGTCGGTATCGTTTGAAAGCGTC
AGCTTTTCATACCCGAGTCGGCCCGACGCGCCCATTTTGCGGGACGTTTCACTCGACATCCCACCGGGCTCCTTC
GTCGCTCTCGTAGGCACAAGTGGCGCCGGCAAGTCGACCGTTTTGTCGCTCCTGCAGAGGCTGTACAGGCCCGCG
TCCGGCACCATCCGACTGGACGGGTACGACATCACGAGACGGATACCTGACAGGACCGGAGAGAAGGAGCAGACT
GCAGACGAGGAGGAAGAAGTAGAAGAAGATGACCTGCCGATCTGGGACGACGTCGCCCTCGTGCCGCAAGACGCC
ACCCTGTTCTCCGGCAGCGTCGCGTTCAACATCGGCCTCGGCGGCCGGGGCACCCGCGAGGCGACGCCGGCGGAG
ATTGAGGAGGCGGCGCGGCTGGCCAACATCCACGAGACGATCAGGGCGCTGCCGCAGGGCTACGAGACGCTCTGC
GGACCCACCGGGTCGCAGTTCTTCTCGGGGGGGCAGAAGCAGCGGCTGTGCATCGCACGGGCGCTGCTCCGGCGG
CCGCGGCTGCTGCTGCTGGACGAGCCGAGCAGCGCCATGGACGCGGAGAGCGAGGCGCTGTGGGAGCGGTCGCTG
GAGAGCATCATGGGCGCGGGCTCGGGCGGGCGGCGGAGGGTGACGGTGGTGGGCATCGCCCACCGGCTGCGGACG
ATCATGAAGGCGGACAGGATCTTCGTGATGGAGGGCGGGCGGGTGCTGGACGCGGGGACGCACGGCGAGCTGGTG
GCGCGCTGCGGCAAGTACCGCGACGACGTGATGCACCAGTCTCTGGGCTGA
Transcript >Hirsu2|9221
ATGGGCTCTGGCGAGAAAGACGCATCTGGCCGAGATGGCGGCGCCACCGCCAACGCCGATGACGGCGGCAGCAAG
AAGCCCCTTGCCGCTGCTCTCGGCTATCTTGGCCTCCTGACGGCCGCCGGCCCCGCGGCGCTGGACTACGCCCTG
CTCGTCGTCGGCGTCCTCGCCTCCATTGCTGCCGGCGTGCCCTTCCCCATCATGTCTCTTCTCTTCGGCCAGCTG
CTCGACCAGTTGAGCGAGGCGTCGTGCTCGAGCAAGCCCCCCTCTGCCTCGTACCACGCCGCTCTGTCGCAAAAG
GTTCTCCTGACCGTCTACGTCACCTTCGCCAACTTCGCCCTCATCTATCTCTCGACCGGCGCCTGGAGCCTGTTC
GGCGAGCGCCTTGTTCGCCGCTTGCGCTACGGCTATCTCTGTGCTCTTCTGCGCCAAGAGATCGCCTTCTTCGAG
ACGCTCGAGACCGGCCATGTGGCCGCACGCCTCGACTCGGATCTGCTCACCATCCAGACGGGCGTCTCCGAAAAG
GTCGGCATCGTCATACAGTCCGTCTCCTACTTCGCCGTCGCCTACATCGTCGCCTTCATCAAGGCCCCCAAGCTG
GCCGGCATGCTCTTCAGCCTCGTGCCCGCCTACTTCATCATGGCCTTCATCGGCACCCACCTCTCCGGCAAGTAC
CGGGCCGTCGTCGAGAAGCGCATGGACCGCGCCACCTCTCTTGCCTCCGAGTCGCTGGCCAACATCAAGCTCATC
AAAGCCTTTCATGCCGGCAAAAGGATTCAGCTCATTTTCGACGACTACCTGGCCGCGACCAGGCGGCCGGGCATC
ATCCGGCTCGTCACGGCAGCGATCCAGATGGGTCTGCTCTACTTCATCGCCTTCTCCGCAAACGCCCTCGCCTTT
TCTCAGGGCGGCAAGCAGGTCGCCGAGGCCAGGCAAAAGGGCGACTCGAACCTCACCCTCGGCGCCGTATACACC
GTCATGGTCTCTCTCATTGACGCGTCGTATATCATCAGCCAGATCGCCCCCTTTCTCAACATGTTCGCCGCCGCC
TCGCAGACGGCCGAAAAGATTTTGATCACTATGAGTCGAAAGCCCACCATCGACTCCTCTCCGGAAGCGCGTGGT
CTGGTAATGGCGGCGATCGAGGGACGTGTCGAGTTGAGGGACGTTTCCTTCCGCTATCCCTCCCGTCAGGAGACG
GTCATCCTGGACAAGCTCAATCTTACCATTCCCGCGGGCAAAATGACGGGCATCGTTGGTCTTTCCGGCAGCGGC
AAATCCACCGTCGCCTCGCTCATTCAGCGCTTCTACGATCCGACTGAGGGTTCCATTTTCGTTGACGGCCACGAC
GTGCGGGAGCTCAACTTGCAGTCCCTGCGCGGCCATATCGGATACGTGGAGCAGAGCCCCGTGCTGTTCAACCGC
TCGATCCTGGAAAACATCGCCCACGGCTTGGTGAGCTCGTCTCGGCCGGAACACTGGGACTTGCGGCCCTTGCTG
GTAAGCGGCGAGGTGGCTGATCTGGCCGAAGCTGTGCGCAATGGTGGCGATGCCGATCAGCTTGCGGGTCCGTCG
AGTGAGATGGCCCGCCTTCTCTCGCTCGTCCGAGTCGCCGCCGGTCAGGCCGGACTGGATGCGTTTCTCGACAAA
TTTCCGCAAGGCCTGGCAACGTCGGTCGGTCCCGGAGGCAATCGCTTGAGTGGCGGACAGAAACAGCGCGTCGCT
CTGGCTCGTACCCTGATCCGAAACCCTTCCATCTTGATACTAGACGAGGCGACTGCGTCTCTCGACTCGACGACC
GAGATCCAGATCCGAGACGCCATCGAGGGCCTGGCGGGGCAACGCACGGTCATATGCATCGCCCATCGCCTCAGC
ACGGTCAAGAACGCGCACACCATCGTCGTCATGCGAGCCGGCGGACAGATTGCAGAGCAGGGAAGCTACGACGAA
TTGATGAACCTCGACGGAGATTTCGCGTCCATGGTCCGCTCTCAGGCTATTCCCCGAGACGAGAAAGATTCGGAT
ACGATCGTAGCCGAGTCTCTTGGCGATTCTGGGCCGCATGGGGACATGTTGCTGGAAAAGGCTGCGTTCGCGCGG
GACGGCGACGTTTCTGAGAAGCCCAGGCCCGGCGACGAGGGAGAGACTGGCAACGCGACGAACTCTCAAGCATTC
GACGCCAACCGAGGCTTCTTGTCGACATTTGTGCTCATTCTCAAGATGGCGCGCCCGCAGCTGCTGCTCATCGTG
ACGGGCTTTCTCTCCTCCATCGTCGTCGGCGGGGCCCGTTCGGGAGAGGCCGTCATCTTCGGCAACGCCGTCGAG
CAGCTGTCCGTCTGTCGCTCGACCTCGCAAATGCGCAGCAGCGCCTCTCTCTATGGGCTCCTCTTCTTCGCCCTG
GCCGTCGTCGAGTTCTTCGCCAACGCGCTCTCCGCCGCGTGCTTCGGCTGGGTCTCGGACGAGCTGGTTCGGAGG
CTGCGCTCGCTCGCGATGCGGTCGCTGCTCAGGCGAGAGGTCCGCTGGCACGAGTCGGACGGCCGGACGCCGGGA
AACTTGCTGTCGTACGTGAGCGCGGATGCCGCGGCCATGAGCGGGCTGACGGGCACCATTCTGGGCGTCTCCGTC
TCCGTCGTCGTCATGCTTGTCGCCGCCGTGGTGCTCGCCCACGTGGTGGCCTGGAAGGTCGCCCTTGTGCTCACG
GCCTGCATCCCCCTCATCTTCGGCTCCGGTTTCCTGCGGCTCCGCCTGCTCGCCCAGTTTGCGGAGCGACACGCC
AAGGCATTCGCCGAGTCGGTCAGCACGGCCACCGAGTCCGTCACCCACATACGCACCGTGTCGGCGCTGGCGCTC
CAGGACGAGGTGGCCAGCACCTTTGGCCGGGCGCTTCGAGGGCCGTATCAGGCCACACTCCGGTCCATCGCCTTC
GGCAACGCATGGCTCGCCACCGCCTTCAGCGTCGGAAGCCTGGTCAAGGCGTTGGCGTTTTGGTGGGGGGGTCGG
CTGATCGCGCAGGGCGAGATGACACAATCCGCCTTCTTCATCGCCCTCGTCTCCCTGCTCACGGCGGCCCACTCG
AGCGGGCAGCTCTTCAGCCTAAGCCCGGACGTGACCAAGGCCGCCGTGGCTGCGCGTCGGGTGTTCGGCCTCATC
TGCGCCGACGGACGCATCGACCGCCTGCGAGCGAAGGAGGCCGACGGACAAGGCGATGTCGAGAAGAGGGCGGCG
GCGGAGACGCTGCAGGCCGCGCCTCGTTGTTCCGAGAGCCGTGCGGCGGGCATGTCGGTATCGTTTGAAAGCGTC
AGCTTTTCATACCCGAGTCGGCCCGACGCGCCCATTTTGCGGGACGTTTCACTCGACATCCCACCGGGCTCCTTC
GTCGCTCTCGTAGGCACAAGTGGCGCCGGCAAGTCGACCGTTTTGTCGCTCCTGCAGAGGCTGTACAGGCCCGCG
TCCGGCACCATCCGACTGGACGGGTACGACATCACGAGACGGATACCTGACAGGACCGGAGAGAAGGAGCAGACT
GCAGACGAGGAGGAAGAAGTAGAAGAAGATGACCTGCCGATCTGGGACGACGTCGCCCTCGTGCCGCAAGACGCC
ACCCTGTTCTCCGGCAGCGTCGCGTTCAACATCGGCCTCGGCGGCCGGGGCACCCGCGAGGCGACGCCGGCGGAG
ATTGAGGAGGCGGCGCGGCTGGCCAACATCCACGAGACGATCAGGGCGCTGCCGCAGGGCTACGAGACGCTCTGC
GGACCCACCGGGTCGCAGTTCTTCTCGGGGGGGCAGAAGCAGCGGCTGTGCATCGCACGGGCGCTGCTCCGGCGG
CCGCGGCTGCTGCTGCTGGACGAGCCGAGCAGCGCCATGGACGCGGAGAGCGAGGCGCTGTGGGAGCGGTCGCTG
GAGAGCATCATGGGCGCGGGCTCGGGCGGGCGGCGGAGGGTGACGGTGGTGGGCATCGCCCACCGGCTGCGGACG
ATCATGAAGGCGGACAGGATCTTCGTGATGGAGGGCGGGCGGGTGCTGGACGCGGGGACGCACGGCGAGCTGGTG
GCGCGCTGCGGCAAGTACCGCGACGACGTGATGCACCAGTCTCTGGGCTGA
Gene >Hirsu2|9221
ATGGGCTCTGGCGAGAAAGACGCATCTGGCCGAGATGGCGGCGCCACCGCCAACGCCGATGACGGCGGCAGCAAG
AAGCCCCTTGCCGCTGCTCTCGGCTATCTTGGCCTCCTGACGGCCGCCGGCCCCGCGGCGCTGGACTACGCCCTG
CTCGTCGTCGGCGTCCTCGCCTCCATTGCTGCCGGCGTGCCCTTCCCCATCATGTCTCTTCTCTTCGGCCAGCTG
CTCGACCAGTTGAGCGAGGCGTCGTGCTCGAGCAAGCCCCCCTCTGCCTCGTACCACGCCGCTCTGTCGCAAAAG
GTTCTCCTGACCGTCTACGTCACCTTCGCCAACTTCGCCCTCATCTATCTCTCGACCGGCGCCTGGAGCCTGTTC
GGCGAGCGCCTTGTTCGCCGCTTGCGCTACGGCTATCTCTGTGCTCTTCTGCGCCAAGAGATCGCCTTCTTCGAG
ACGCTCGAGACCGGCCATGTGGCCGCACGCCTCGACTCGGATCTGCTCACCATCCAGACGGGCGTCTCCGAAAAG
GTCGGCATCGTCATACAGTCCGTCTCCTACTTCGCCGTCGCCTACATCGTCGCCTTCATCAAGGCCCCCAAGCTG
GCCGGCATGCTCTTCAGCCTCGTGCCCGCCTACTTCATCATGGCCTTCATCGGCACCCACCTCTCCGGCAAGTAC
CGGGCCGTCGTCGAGAAGCGCATGGACCGCGCCACCTCTCTTGCCTCCGAGTCGCTGGCCAACATCAAGCTCATC
AAAGCCTTTCATGCCGGCAAAAGGATTCAGCTCATTTTCGACGACTACCTGGCCGCGACCAGGCGGCCGGGCATC
ATCCGGCTCGTCACGGCAGCGATCCAGATGGGTCTGCTCTACTTCATCGCCTTCTCCGCAAACGCCCTCGCCTTT
TCTCAGGGCGGCAAGCAGGTCGCCGAGGCCAGGCAAAAGGGCGACTCGAACCTCACCCTCGGCGCCGTATACACC
GTCATGGTCTCTCTCATTGACGGTACGCCGACTCTGCTCCTCGCGCCGTTCCATCTTCCCCTCTCCCCTCCTCTC
TCCATTCAGCGCGCCGATTCTCCGACGATCCCCACCAACTGACCTCCCCCCCCCCCTTGCAGCGTCGTATATCAT
CAGCCAGATCGCCCCCTTTCTCAACATGTTCGCCGCCGCCTCGCAGACGGCCGAAAAGATTTTGATCACTATGAG
TCGAAAGCCCACCATCGACTCCTCTCCGGAAGCGCGTGGTCTGGTAATGGCGGCGATCGAGGGACGTGTCGAGTT
GAGGGACGTTTCCTTCCGCTATCCCTCCCGTCAGGAGACGGTCATCCTGGACAAGCTCAATCTTACCATTCCCGC
GGGCAAAATGACGGGCATCGTTGGTCTTTCCGGCAGCGGCAAATCCACCGTCGCCTCGCTCATTCAGCGCTTCTA
CGATCCGACTGAGGGTTCCATTTTCGTTGACGGCCACGACGTGCGGGAGCTCAACTTGCAGTCCCTGCGCGGCCA
TATCGGATACGTGGAGCAGAGCCCCGTGCTGTTCAACCGCTCGATCCTGGAAAACATCGCCCACGGCTTGGTGAG
CTCGTCTCGGCCGGAACACTGGGACTTGCGGCCCTTGCTGGTAAGCGGCGAGGTGGCTGATCTGGCCGAAGCTGT
GCGCAATGGTGGCGATGCCGATCAGCTTGCGGGTCCGTCGAGTGAGATGGCCCGCCTTCTCTCGCTCGTCCGAGT
CGCCGCCGGTCAGGCCGGACTGGATGCGTTTCTCGACAAATTTCCGCAAGGCCTGGCAACGTCGGTCGGTCCCGG
AGGCAATCGCTTGAGTGGCGGACAGAAACAGCGCGTCGCTCTGGCTCGTACCCTGATCCGAAACCCTTCCATCTT
GATACTAGACGAGGCGACTGCGTCTCTCGACTCGACGACCGAGATCCAGATCCGAGACGCCATCGAGGGCCTGGC
GGGGCAACGCACGGTCATATGCATCGCCCATCGCCTCAGCACGGTCAAGAACGCGCACACCATCGTCGTCATGCG
AGCCGGCGGACAGATTGCAGAGCAGGGAAGCTACGACGAATTGATGAACCTCGACGGAGATTTCGCGTCCATGGT
CCGCTCTCAGGCTATTCCCCGAGACGAGAAAGATTCGGATACGATCGTAGCCGAGTCTCTTGGCGATTCTGGGCC
GCATGGGGACATGTTGCTGGAAAAGGCTGCGTTCGCGCGGGACGGCGACGTTTCTGAGAAGCCCAGGCCCGGCGA
CGAGGGAGAGACTGGCAACGCGACGAACTCTCAAGCATTCGACGCCAACCGAGGCTTCTTGTCGACATTTGTGCT
CATTCTCAAGATGGCGCGCCCGCAGCTGCTGCTCATCGTGACGGGCTTTCTCTCCTCCATCGTCGTCGGCGGGGC
CCGTTCGGGAGAGGCCGTCATCTTCGGCAACGCCGTCGAGCAGCTGTCCGTCTGTCGCTCGACCTCGCAAATGCG
CAGCAGCGCCTCTCTCTATGGGCTCCTCTTCTTCGCCCTGGCCGTCGTCGAGTTCTTCGCCAACGCGCTCTCCGC
CGCGTGCTTCGGCTGGGTCTCGGACGAGCTGGTTCGGAGGCTGCGCTCGCTCGCGATGCGGTCGCTGCTCAGGCG
AGAGGTCCGCTGGCACGAGTCGGACGGCCGGACGCCGGGAAACTTGCTGTCGTACGTGAGCGCGGATGCCGCGGC
CATGAGCGGGCTGACGGGCACCATTCTGGGCGTCTCCGTCTCCGTCGTCGTCATGCTTGTCGCCGCCGTGGTGCT
CGCCCACGTGGTGGCCTGGAAGGTCGCCCTTGTGCTCACGGCCTGCATCCCCCTCATCTTCGGCTCCGGTTTCCT
GCGGCTCCGCCTGCTCGCCCAGTTTGCGGAGCGACACGCCAAGGCATTCGCCGAGTCGGTCAGCACGGCCACCGA
GTCCGTCACCCACATACGCACCGTGTCGGCGCTGGCGCTCCAGGACGAGGTGGCCAGCACCTTTGGCCGGGCGCT
TCGAGGGCCGTATCAGGCCACACTCCGGTCCATCGCCTTCGGCAACGCATGGCTCGCCACCGCCTTCAGCGTCGG
AAGCCTGGTCAAGGCGTTGGCGTTTTGGTGGGGGGGTCGGCTGATCGCGCAGGGCGAGATGACACAATCCGCCTT
CTTCATCGCCCTCGTCTCCCTGCTCACGGCGGCCCACTCGAGCGGGCAGCTCTTCAGCCTAAGCCCGGACGTGAC
CAAGGCCGCCGTGGCTGCGCGTCGGGTGTTCGGCCTCATCTGCGCCGACGGACGCATCGACCGCCTGCGAGCGAA
GGAGGCCGACGGACAAGGCGATGTCGAGAAGAGGGCGGCGGCGGAGACGCTGCAGGCCGCGCCTCGTTGTTCCGA
GAGCCGTGCGGCGGGCATGTCGGTATCGTTTGAAAGCGTCAGCTTTTCATACCCGAGTCGGCCCGACGCGCCCAT
TTTGCGGGACGTTTCACTCGACATCCCACCGGGCTCCTTCGTCGCTCTCGTAGGCACAAGTGGCGCCGGCAAGTC
GACCGTTTTGTCGCTCCTGCAGAGGCTGTACAGGCCCGCGTCCGGCACCATCCGACTGGACGGGTACGACATCAC
GAGACGGATACCTGACAGGACCGGAGAGAAGGAGCAGACTGCAGACGAGGAGGAAGAAGTAGAAGAAGATGACCT
GCCGATCTGGGACGACGTCGCCCTCGTGCCGCAAGACGCCACCCTGTTCTCCGGCAGCGTCGCGTTCAACATCGG
CCTCGGCGGCCGGGGCACCCGCGAGGCGACGCCGGCGGAGATTGAGGAGGCGGCGCGGCTGGCCAACATCCACGA
GACGATCAGGGCGCTGCCGCAGGGCTACGAGACGCTCTGCGGACCCACCGGGTCGCAGTTCTTCTCGGGGGGGCA
GAAGCAGCGGCTGTGCATCGCACGGGCGCTGCTCCGGCGGCCGCGGCTGCTGCTGCTGGACGAGCCGAGCAGCGC
CATGGACGCGGAGAGCGAGGCGCTGTGGGAGCGGTCGCTGGAGAGCATCATGGGCGCGGGCTCGGGCGGGCGGCG
GAGGGTGACGGTGGTGGGCATCGCCCACCGGCTGCGGACGATCATGAAGGCGGACAGGATCTTCGTGATGGAGGG
CGGGCGGGTGCTGGACGCGGGGACGCACGGCGAGCTGGTGGCGCGCTGCGGCAAGTACCGCGACGACGTGATGCA
CCAGTCTCTGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail