Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9218
Gene name
LocationContig_656:9356..9578
Strand-
Gene length (bp)222
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4856 0.4956 0.2308 0.1729 0.3186 0.0298 0.1321 0.1963 0.2218 0.0078

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup87
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2106
Ophiocordyceps australis 1348a (Ghana) OphauG2|2432
Ophiocordyceps australis 1348a (Ghana) OphauG2|3791
Ophiocordyceps australis 1348a (Ghana) OphauG2|7785
Ophiocordyceps australis map64 (Brazil) OphauB2|538
Ophiocordyceps australis map64 (Brazil) OphauB2|7106
Ophiocordyceps australis map64 (Brazil) OphauB2|8110
Ophiocordyceps camponoti-floridani Ophcf2|04348
Ophiocordyceps camponoti-floridani Ophcf2|06291
Ophiocordyceps camponoti-rufipedis Ophun1|2615
Ophiocordyceps camponoti-rufipedis Ophun1|3024
Ophiocordyceps kimflemingae Ophio5|6311
Ophiocordyceps kimflemingae Ophio5|7302
Ophiocordyceps subramaniannii Hirsu2|3102
Ophiocordyceps subramaniannii Hirsu2|9218 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9218
MHCTKLAGNETKMGGITYHLINLNQLPVGYAKAPLKTLRYLGKESKGYVLAGDIDIARGQRGKKSAVLDPFSV*
Coding >Hirsu2|9218
ATGCACTGCACCAAGCTGGCGGGCAACGAGACCAAGATGGGCGGCATCACGTACCACCTCATCAACCTCAACCAG
CTACCGGTGGGATACGCCAAGGCGCCGCTCAAGACGCTCCGCTACCTGGGGAAAGAGAGCAAGGGGTATGTGCTG
GCCGGAGACATCGATATTGCACGGGGCCAGCGCGGAAAGAAGAGCGCGGTGTTGGACCCGTTTAGTGTCTGA
Transcript >Hirsu2|9218
ATGCACTGCACCAAGCTGGCGGGCAACGAGACCAAGATGGGCGGCATCACGTACCACCTCATCAACCTCAACCAG
CTACCGGTGGGATACGCCAAGGCGCCGCTCAAGACGCTCCGCTACCTGGGGAAAGAGAGCAAGGGGTATGTGCTG
GCCGGAGACATCGATATTGCACGGGGCCAGCGCGGAAAGAAGAGCGCGGTGTTGGACCCGTTTAGTGTCTGA
Gene >Hirsu2|9218
ATGCACTGCACCAAGCTGGCGGGCAACGAGACCAAGATGGGCGGCATCACGTACCACCTCATCAACCTCAACCAG
CTACCGGTGGGATACGCCAAGGCGCCGCTCAAGACGCTCCGCTACCTGGGGAAAGAGAGCAAGGGGTATGTGCTG
GCCGGAGACATCGATATTGCACGGGGCCAGCGCGGAAAGAAGAGCGCGGTGTTGGACCCGTTTAGTGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail