Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9214
Gene name
LocationContig_656:2009..4534
Strand-
Gene length (bp)2525
Transcript length (bp)2256
Coding sequence length (bp)2256
Protein length (aa) 752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01480 PWI PWI domain 3.1E-12 677 743

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8WZK0|US107_SCHPO U1 snRNP-associated protein usp107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp107 PE=1 SV=1 133 738 4.0E-22
sp|P49756|RBM25_HUMAN RNA-binding protein 25 OS=Homo sapiens GN=RBM25 PE=1 SV=3 580 749 3.0E-19
sp|B2RY56|RBM25_MOUSE RNA-binding protein 25 OS=Mus musculus GN=Rbm25 PE=1 SV=2 580 749 4.0E-19

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0046483 heterocycle metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0016071 mRNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9214
MSYNQYGGNPYGAPPGYGGYGNLPPGMGAPPPGLGPPPGMPSAPGMAAPPGVPQPTTQQANRPAGLPPSFQPPAN
MPNINFNAPVIRLGTGTPGGSGGRGEGPSAPPSGRSGMGMERGGDAGRERAREAPQILVPATADEKLRTIVIYNL
TEGLGGDDGVQKICSAVGRLRKWECSAGIWAEHKPRLGLALFDDHDSVTIALKLLREQALEVPVKRQQATANPAQ
DDAFEGIEKTELKVAVDEATMEYQASLSEARGAEDAELQGRLESARAALKQVQLELFYPPLGSRADADADAGANA
NDGQGNVEVVNISIAQEDELADIPAEMREIVAKEIAAFRDRSNQRDMERLRREEEIGARFRQQNGASSGPSLGGG
ANNIPLGPRAATMASTASGPKGQNGADRSVSFVNGGAGDADHAAHEGGNGTDASDDELYRRRLAKKEDEEHKIFG
EMERKWLNRERSRQLALDREQERERQEEEQKQRRKDEQRDREMGWDDELETSRKTHPYYRDHASWARKRAVERQE
EEMRDEMERRDEDDERRREQAQLERARGQADSFLDRQDREAERRQAASAPAPQPFKLSLGAAAQRAQASRAMPQR
RTIAEVEGLLDDEDAEPSVRRQLVPIQMDAVTGPGAMSEEEISQAVRALAQEIPSDKDGLWAWEVKWDYMDESII
GDRLRPFVEKKIVEYLGVQEEMLVATVEEHLRKHGTAAGLVEELEGPLDDEAEDLVKKLWRMVIFFTECEKRNLP
T*
Coding >Hirsu2|9214
ATGTCCTACAACCAGTACGGGGGAAATCCCTACGGCGCGCCGCCTGGCTACGGCGGCTATGGCAACCTGCCACCC
GGCATGGGTGCTCCCCCTCCCGGCCTAGGCCCCCCTCCCGGCATGCCATCCGCCCCCGGCATGGCCGCTCCCCCG
GGGGTCCCCCAGCCGACGACGCAGCAAGCGAACCGTCCCGCGGGGCTGCCCCCCAGCTTCCAGCCTCCGGCAAAC
ATGCCCAACATCAACTTTAACGCCCCGGTCATTCGACTCGGCACCGGCACCCCCGGCGGCTCGGGCGGGCGAGGC
GAAGGTCCTTCGGCGCCGCCTAGCGGGCGGTCCGGCATGGGCATGGAGAGAGGCGGCGACGCGGGCCGAGAGCGC
GCCCGAGAGGCCCCTCAGATTCTCGTGCCCGCCACGGCCGACGAGAAGCTCCGCACGATCGTCATCTACAACCTC
ACCGAGGGACTTGGCGGTGACGACGGCGTGCAGAAGATCTGCAGCGCGGTCGGACGCCTCCGAAAGTGGGAATGC
TCGGCGGGCATCTGGGCGGAGCACAAGCCGCGGCTGGGCCTCGCCCTCTTCGACGATCACGACTCCGTCACGATT
GCCCTGAAACTTCTCCGAGAGCAGGCCCTGGAGGTTCCCGTCAAGCGACAGCAGGCGACGGCCAATCCCGCCCAG
GACGACGCGTTCGAAGGCATCGAGAAAACAGAGCTGAAGGTGGCAGTCGACGAGGCAACGATGGAGTACCAGGCG
TCGCTCAGCGAGGCCAGAGGAGCAGAGGACGCCGAGCTCCAGGGCAGGCTTGAGTCGGCCCGTGCGGCGCTGAAG
CAGGTTCAGCTCGAGCTCTTCTACCCCCCGCTCGGCAGCCGAGCCGACGCCGACGCCGACGCGGGCGCCAACGCG
AACGACGGCCAGGGCAACGTCGAGGTGGTGAATATCTCCATTGCGCAGGAGGACGAGCTTGCTGACATCCCGGCC
GAAATGCGGGAGATTGTGGCCAAGGAGATTGCCGCGTTCCGCGACCGGAGCAACCAGCGCGACATGGAACGCCTT
AGGAGGGAGGAGGAAATCGGCGCGCGGTTCCGGCAGCAGAACGGGGCGTCGTCCGGGCCGTCACTGGGAGGAGGA
GCAAACAACATTCCGCTGGGCCCGCGGGCAGCGACGATGGCATCGACCGCCTCCGGACCCAAGGGCCAGAACGGG
GCCGATCGCAGCGTGTCCTTTGTGAACGGCGGAGCGGGCGATGCAGACCACGCGGCCCACGAGGGGGGCAACGGC
ACGGACGCTAGCGACGACGAGCTGTACCGCCGAAGGCTGGCGAAGAAGGAGGACGAGGAGCACAAGATCTTCGGA
GAAATGGAGCGCAAGTGGCTGAACCGAGAGCGCTCGAGACAGCTGGCGTTGGACCGCGAGCAGGAGCGCGAGCGG
CAGGAAGAGGAGCAGAAGCAGAGACGCAAGGACGAACAGCGCGACCGCGAGATGGGCTGGGACGACGAGCTGGAG
ACGAGTCGTAAGACGCACCCGTACTACCGCGACCACGCCTCGTGGGCGAGAAAGCGCGCGGTGGAGCGGCAGGAG
GAGGAGATGAGAGACGAGATGGAGCGGCGGGACGAGGACGACGAGCGACGACGCGAGCAGGCGCAGCTGGAGCGA
GCACGGGGCCAGGCCGACTCGTTCCTGGACCGGCAGGACCGCGAGGCGGAGCGGCGGCAGGCGGCGTCGGCGCCG
GCGCCGCAGCCGTTCAAGCTGTCGCTGGGCGCCGCGGCGCAGCGGGCGCAGGCGTCGCGGGCGATGCCGCAGCGG
CGGACGATCGCCGAGGTCGAGGGCCTGCTGGACGACGAGGATGCGGAGCCGTCGGTGCGGCGGCAGCTGGTGCCG
ATCCAGATGGACGCCGTCACGGGCCCCGGGGCCATGTCGGAGGAGGAGATATCCCAGGCGGTGCGGGCGCTGGCG
CAGGAGATCCCGTCGGACAAGGACGGCCTCTGGGCCTGGGAGGTCAAGTGGGACTACATGGACGAGAGCATCATC
GGCGACCGGCTGCGGCCCTTCGTCGAGAAGAAGATCGTCGAGTACCTGGGCGTGCAGGAGGAGATGCTGGTGGCG
ACGGTCGAGGAGCACCTCCGCAAGCACGGAACGGCCGCCGGCCTGGTCGAGGAACTGGAAGGGCCCCTGGACGAC
GAGGCAGAGGACCTTGTCAAGAAACTCTGGCGCATGGTCATCTTCTTCACCGAGTGCGAGAAGCGCAACTTGCCG
ACCTAG
Transcript >Hirsu2|9214
ATGTCCTACAACCAGTACGGGGGAAATCCCTACGGCGCGCCGCCTGGCTACGGCGGCTATGGCAACCTGCCACCC
GGCATGGGTGCTCCCCCTCCCGGCCTAGGCCCCCCTCCCGGCATGCCATCCGCCCCCGGCATGGCCGCTCCCCCG
GGGGTCCCCCAGCCGACGACGCAGCAAGCGAACCGTCCCGCGGGGCTGCCCCCCAGCTTCCAGCCTCCGGCAAAC
ATGCCCAACATCAACTTTAACGCCCCGGTCATTCGACTCGGCACCGGCACCCCCGGCGGCTCGGGCGGGCGAGGC
GAAGGTCCTTCGGCGCCGCCTAGCGGGCGGTCCGGCATGGGCATGGAGAGAGGCGGCGACGCGGGCCGAGAGCGC
GCCCGAGAGGCCCCTCAGATTCTCGTGCCCGCCACGGCCGACGAGAAGCTCCGCACGATCGTCATCTACAACCTC
ACCGAGGGACTTGGCGGTGACGACGGCGTGCAGAAGATCTGCAGCGCGGTCGGACGCCTCCGAAAGTGGGAATGC
TCGGCGGGCATCTGGGCGGAGCACAAGCCGCGGCTGGGCCTCGCCCTCTTCGACGATCACGACTCCGTCACGATT
GCCCTGAAACTTCTCCGAGAGCAGGCCCTGGAGGTTCCCGTCAAGCGACAGCAGGCGACGGCCAATCCCGCCCAG
GACGACGCGTTCGAAGGCATCGAGAAAACAGAGCTGAAGGTGGCAGTCGACGAGGCAACGATGGAGTACCAGGCG
TCGCTCAGCGAGGCCAGAGGAGCAGAGGACGCCGAGCTCCAGGGCAGGCTTGAGTCGGCCCGTGCGGCGCTGAAG
CAGGTTCAGCTCGAGCTCTTCTACCCCCCGCTCGGCAGCCGAGCCGACGCCGACGCCGACGCGGGCGCCAACGCG
AACGACGGCCAGGGCAACGTCGAGGTGGTGAATATCTCCATTGCGCAGGAGGACGAGCTTGCTGACATCCCGGCC
GAAATGCGGGAGATTGTGGCCAAGGAGATTGCCGCGTTCCGCGACCGGAGCAACCAGCGCGACATGGAACGCCTT
AGGAGGGAGGAGGAAATCGGCGCGCGGTTCCGGCAGCAGAACGGGGCGTCGTCCGGGCCGTCACTGGGAGGAGGA
GCAAACAACATTCCGCTGGGCCCGCGGGCAGCGACGATGGCATCGACCGCCTCCGGACCCAAGGGCCAGAACGGG
GCCGATCGCAGCGTGTCCTTTGTGAACGGCGGAGCGGGCGATGCAGACCACGCGGCCCACGAGGGGGGCAACGGC
ACGGACGCTAGCGACGACGAGCTGTACCGCCGAAGGCTGGCGAAGAAGGAGGACGAGGAGCACAAGATCTTCGGA
GAAATGGAGCGCAAGTGGCTGAACCGAGAGCGCTCGAGACAGCTGGCGTTGGACCGCGAGCAGGAGCGCGAGCGG
CAGGAAGAGGAGCAGAAGCAGAGACGCAAGGACGAACAGCGCGACCGCGAGATGGGCTGGGACGACGAGCTGGAG
ACGAGTCGTAAGACGCACCCGTACTACCGCGACCACGCCTCGTGGGCGAGAAAGCGCGCGGTGGAGCGGCAGGAG
GAGGAGATGAGAGACGAGATGGAGCGGCGGGACGAGGACGACGAGCGACGACGCGAGCAGGCGCAGCTGGAGCGA
GCACGGGGCCAGGCCGACTCGTTCCTGGACCGGCAGGACCGCGAGGCGGAGCGGCGGCAGGCGGCGTCGGCGCCG
GCGCCGCAGCCGTTCAAGCTGTCGCTGGGCGCCGCGGCGCAGCGGGCGCAGGCGTCGCGGGCGATGCCGCAGCGG
CGGACGATCGCCGAGGTCGAGGGCCTGCTGGACGACGAGGATGCGGAGCCGTCGGTGCGGCGGCAGCTGGTGCCG
ATCCAGATGGACGCCGTCACGGGCCCCGGGGCCATGTCGGAGGAGGAGATATCCCAGGCGGTGCGGGCGCTGGCG
CAGGAGATCCCGTCGGACAAGGACGGCCTCTGGGCCTGGGAGGTCAAGTGGGACTACATGGACGAGAGCATCATC
GGCGACCGGCTGCGGCCCTTCGTCGAGAAGAAGATCGTCGAGTACCTGGGCGTGCAGGAGGAGATGCTGGTGGCG
ACGGTCGAGGAGCACCTCCGCAAGCACGGAACGGCCGCCGGCCTGGTCGAGGAACTGGAAGGGCCCCTGGACGAC
GAGGCAGAGGACCTTGTCAAGAAACTCTGGCGCATGGTCATCTTCTTCACCGAGTGCGAGAAGCGCAACTTGCCG
ACCTAG
Gene >Hirsu2|9214
ATGTCCTACAACCAGTACGGGGGTGAGTTGGCGCGGGCCTCGCCGGCGGATGCGGAAGACGCTGGCCGGCTAACC
CTCGTTACCTCGTGCAGGAAATCCCTACGGCGCGCCGCCTGGCTACGGCGGCTATGGCAACCTGCCACCCGGCAT
GGGTGCTCCCCCTCCCGGCCTAGGTACTGACCTGGCCCGGCCCAGCTCGCGAAGCGGACGCGATGGAGCGGAAAG
TGCTGACTCGGAGCTCTCAGGCCCCCCTCCCGGCATGCCATCCGCCCCCGGCATGGCCGCTCCCCCGGGGGTCCC
CCAGCCGACGACGCAGCAAGCGAACCGTCCCGCGGGGCTGCCCCCCAGCTTCCAGCCTCCGGCAAACATGCCCAA
CATCAACTTTAACGCCCCGGTCATTCGACTCGGCACCGGCACCCCCGGCGGCTCGGGCGGGCGAGGCGAAGGTCC
TTCGGCGCCGCCTAGCGGGCGGTCCGGCATGGGCATGGAGAGAGGCGGCGACGCGGGCCGAGAGCGCGCCCGAGA
GGCCCCTCAGATTCTCGTGCCCGCCACGGCCGACGAGAAGCTCCGCACGATCGTCATCTACAACCTCACCGAGGG
ACTTGGCGGTGACGACGGCGTGCAGAAGATCTGCAGCGCGGTCGGACGCCTCCGAAAGTGGGAATGCTCGGCGGG
CATCTGGGCGGAGCACAAGCCGCGGCTGGGCCTCGCCCTCTTCGACGATCACGACTCCGTCACGATTGCCCTGAA
ACTTCTCCGAGAGCAGGCCCTGGAGGTTCCCGTCAAGCGACAGCAGGCGACGGCCAATCCCGCCCAGGACGACGC
GTTCGAAGGCATCGAGAAAACAGAGCTGAAGGTGGCAGTCGACGAGGCAACGATGGAGTACCAGGCGTCGCTCAG
CGAGGCCAGAGGAGCAGAGGACGCCGAGCTCCAGGGCAGGCTTGAGTCGGCCCGTGCGGCGCTGAAGCAGGTTCA
GCTCGAGCTCTTCTACCCCCCGCTCGGCAGCCGAGCCGACGCCGACGCCGACGCGGGCGCCAACGCGAACGACGG
CCAGGGCAACGTCGAGGTGGTGAATATCTCCATTGCGCAGGAGGACGAGCTTGCTGACATCCCGGCCGAAATGCG
GGAGATTGTGGCCAAGGAGATTGCCGCGTTCCGCGACCGGAGCAACCAGCGCGACATGGAACGCCTTAGGAGGGA
GGAGGAAATCGGCGCGCGGTTCCGGCAGCAGAACGGGGCGTCGTCCGGGCCGTCACTGGGAGGAGGAGCAAACAA
CATTCCGCTGGGCCCGCGGGCAGCGACGATGGCATCGACCGCCTCCGGACCCAAGGGCCAGAACGGGGCCGATCG
CAGCGTGTCCTTTGTGAACGGCGGAGCGGGCGATGCAGACCACGCGGCCCACGAGGGGGGCAACGGCACGGACGC
TAGCGACGACGAGCTGTACCGCCGAAGGCTGGCGAAGAAGGAGGACGAGGAGCACAAGATCTTCGGAGAAATGGA
GCGCAAGTGGCTGAACCGAGAGCGCTCGAGACAGCTGGCGTTGGACCGCGAGCAGGAGCGCGAGCGGCAGGAAGA
GGAGCAGAAGCAGAGACGCAAGGACGAACAGCGCGACCGCGAGATGGGCTGGGACGACGAGCTGGAGACGAGTCG
TAAGACGCACCCGTACTACCGCGACCACGCCTCGTGGGCGAGAAAGCGCGCGGTGGAGCGGCAGGAGGAGGAGAT
GAGAGACGAGATGGAGCGGCGGGACGAGGACGACGAGCGACGACGCGAGCAGGCGCAGCTGGAGCGAGCACGGGG
CCAGGCCGACTCGTTCCTGGACCGGCAGGACCGCGAGGCGGAGCGGCGGCAGGCGGCGTCGGCGCCGGCGCCGCA
GCCGTTCAAGCTGTCGCTGGGCGCCGCGGCGCAGCGGGCGCAGGCGTCGCGGGCGATGCCGCAGCGGCGGACGAT
CGCCGAGGTCGAGGGCCTGCTGGACGACGAGGATGCGGAGCCGTCGGTGCGGCGGCAGCTGGTGCCGATCCAGAT
GGACGCCGTCACGGGCCCCGGGGCCATGTCGGAGGAGGAGATATCCCAGGCGGTGCGGGCGCTGGCGCAGGAGAT
CCCGTCGGACAAGGACGGCCTCTGGGCCTGGGAGGTCAAGTGGGACTACATGGACGAGAGCATCATCGGCGACCG
GCTGCGGCCCTTCGTCGAGAAGAAGATCGTCGAGTACCTGGGCGTGCAGGAGGAGATGCTGGTGGCGACGGTCGA
GGAGCACCTCCGCAAGCACGGAACGGCCGCCGGCCTGGTCGAGGAACTGGAAGGGGTAAGTCGATGGATCCCCCG
CCCCCTTTGTCACCCTCTCCCTATCCTTCGTGCCTCCGCCCTGCTTGTCTCGGCGCGGAGACTTGTCTGCTTTCT
TTTTTTCTTTGCTGACGCAGACACACGCCCAGCCCCTGGACGACGAGGCAGAGGACCTTGTCAAGAAACTCTGGC
GCATGGTCATCTTCTTCACCGAGTGCGAGAAGCGCAACTTGCCGACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail