Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9208
Gene name
LocationContig_655:678..3472
Strand-
Gene length (bp)2794
Transcript length (bp)2193
Coding sequence length (bp)2193
Protein length (aa) 731

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12246 MKT1_C Temperature dependent protein affecting M2 dsRNA replication 1.7E-69 484 726
PF12247 MKT1_N Temperature dependent protein affecting M2 dsRNA replication 4.4E-32 314 402
PF00752 XPG_N XPG N-terminal domain 1.3E-05 15 100

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40850|MKT1_YEAST Protein MKT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKT1 PE=1 SV=2 12 710 2.0E-27
sp|Q9UTN2|YII1_SCHPO Uncharacterized protein C139.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.01c PE=1 SV=2 18 665 3.0E-25

GO

GO Term Description Terminal node
GO:0004518 nuclease activity Yes
GO:0006281 DNA repair Yes
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0050896 response to stimulus No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0006950 response to stress No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0033554 cellular response to stress No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016787 hydrolase activity No
GO:0051716 cellular response to stimulus No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9208
MPFLLEDSWINGQATTYDVADLEDCAIAVDATYYLNHLLDTPPAHEPLLSALGGLTGIQTHIIENLEQWDRNCIT
PLFVFDGQSITGQDQVSLSRRRAANQKTDDAWNLYSQSQAEQAVATFGANPGAFAVQNLYPLLQRILKDRGLHFL
VPPYNACAQLAYYEMIDSDQCAGVMGPQELLLYPVKDSIIRSFDWEAKTVTALSKKKVMRALGVGEPMFVDAMLM
TGTSFLPPFPPLQDSSMYPNPFTIMDAVNMLRTSDKSMATACASFNDILQAQDPDWLDKYRKARMAVHHFIFIAE
NGEVRVNDAERLTKDNHEYLGLQLPAELFHYLNTGLIGARNLNCITHGQIVVQPTLDGGASDEYRKLVTDKILPL
REQALGLIIPRVHRGIGHKDITMRVWFDAKFARTINHRSLQPPPSQQVGSWDVKEADLGKFFPADFAGPIYLEVL
ALANGDFVELTKAKDKAIRGIDSPEMVTSVAIWRFLHLRGYVNDEHRLTRWGNALATTLLALKEANEGRPEAPGA
DEAALLAFELIRFGLLNGRAGEELPGLPRKGSEEEKSSLTLISQGATLLKLRHQVYGYTGPLNKSLLAFRSLSSA
VREADRDLIEAIVASMFMYGQCKRERDDYLDISQRLPFLQEPDIGLGIAIRTFFDEDEASDSKEGRAAKLAEFPK
TFVPFAEALADDFRLCTDFVGAINQGVQTLDSKELAAADKAAWAKAQAYLDARPF*
Coding >Hirsu2|9208
ATGCCATTCCTTCTGGAGGATTCCTGGATCAATGGCCAGGCCACAACATACGACGTCGCCGACTTGGAAGACTGC
GCCATCGCCGTCGACGCGACCTACTACCTCAACCACCTGCTCGACACTCCGCCGGCCCACGAGCCCCTCCTCTCC
GCCCTCGGCGGCCTGACCGGCATCCAAACGCACATCATCGAGAACCTCGAGCAGTGGGACAGGAACTGTATCACA
CCTCTTTTCGTCTTCGACGGCCAGTCCATCACAGGCCAGGACCAGGTTTCGCTAAGCCGCCGACGCGCCGCCAAC
CAGAAGACGGACGATGCCTGGAACCTGTATTCGCAGTCCCAGGCCGAGCAGGCCGTGGCCACCTTTGGCGCTAAC
CCCGGTGCCTTTGCCGTCCAGAACCTCTACCCTCTTCTCCAGAGGATCCTGAAGGACCGGGGACTGCACTTCCTG
GTCCCCCCGTACAACGCCTGCGCTCAGCTCGCGTATTACGAGATGATAGACTCGGACCAGTGTGCGGGTGTCATG
GGTCCGCAAGAGCTTCTCCTCTATCCCGTCAAGGACTCCATCATCCGAAGCTTCGACTGGGAAGCCAAGACGGTG
ACGGCCCTGTCCAAGAAGAAGGTGATGCGGGCGCTCGGGGTGGGCGAGCCCATGTTCGTCGACGCCATGCTCATG
ACGGGCACCTCGTTTCTCCCGCCCTTCCCGCCGCTCCAGGACTCGTCCATGTACCCGAACCCCTTCACCATCATG
GACGCGGTCAACATGCTGCGCACGTCTGACAAGTCGATGGCGACGGCCTGCGCCTCCTTCAACGACATACTCCAG
GCGCAGGACCCGGACTGGCTGGACAAGTACCGCAAGGCGCGCATGGCCGTCCACCACTTCATCTTCATCGCGGAG
AACGGCGAGGTGCGGGTCAACGACGCGGAGCGGCTGACCAAGGACAACCACGAGTACCTGGGCCTCCAGCTGCCG
GCGGAGCTGTTCCACTACCTCAACACGGGCCTGATCGGGGCGCGGAATCTGAACTGTATAACGCACGGGCAGATC
GTGGTGCAGCCGACGCTGGACGGCGGGGCGTCGGACGAGTACAGGAAGCTGGTGACGGACAAGATCCTGCCGCTC
AGGGAGCAGGCGCTGGGGCTCATCATCCCGCGGGTGCACCGCGGCATCGGGCACAAGGACATTACGATGCGCGTC
TGGTTCGACGCCAAGTTCGCGCGCACGATCAACCACCGGTCCCTGCAGCCGCCGCCGTCGCAGCAGGTCGGCTCG
TGGGACGTCAAGGAGGCGGACCTGGGCAAGTTCTTCCCGGCCGACTTCGCCGGGCCAATCTACCTGGAGGTGCTG
GCGCTGGCGAACGGCGACTTCGTGGAGCTGACCAAGGCCAAGGACAAGGCGATCCGGGGCATCGACAGCCCGGAG
ATGGTGACGTCGGTGGCCATCTGGCGCTTCCTGCACCTGCGTGGCTACGTCAACGACGAGCACAGGCTGACGCGG
TGGGGGAACGCGCTGGCGACGACGCTGCTGGCGCTCAAGGAGGCCAACGAGGGCCGGCCGGAGGCGCCGGGCGCG
GACGAGGCGGCGCTGCTCGCCTTCGAGCTCATCCGGTTCGGCCTGCTCAACGGCAGGGCGGGCGAGGAGCTGCCC
GGGCTGCCGCGCAAGGGGAGCGAGGAGGAGAAGTCGAGCCTGACGCTCATCAGCCAGGGCGCGACGCTGCTGAAG
CTGAGACACCAGGTCTACGGGTACACGGGCCCTCTGAACAAGAGCCTGCTGGCCTTCCGCTCGCTGTCGTCGGCG
GTGCGGGAGGCGGACCGGGACCTGATCGAGGCGATTGTGGCGTCGATGTTCATGTACGGGCAGTGCAAGAGGGAG
AGGGACGACTACTTGGATATCAGCCAGAGGCTTCCGTTTTTGCAGGAGCCGGACATTGGGCTCGGCATCGCGATC
CGGACCTTCTTCGACGAGGACGAGGCGAGCGACAGCAAAGAGGGGCGGGCGGCCAAGCTGGCCGAGTTCCCCAAG
ACGTTTGTGCCGTTCGCGGAGGCGCTGGCGGACGACTTCCGCCTCTGCACGGACTTTGTCGGGGCCATCAACCAA
GGCGTGCAGACGCTGGACAGCAAGGAGCTGGCGGCGGCGGACAAGGCGGCGTGGGCCAAGGCGCAGGCGTACCTG
GACGCGAGGCCGTTTTGA
Transcript >Hirsu2|9208
ATGCCATTCCTTCTGGAGGATTCCTGGATCAATGGCCAGGCCACAACATACGACGTCGCCGACTTGGAAGACTGC
GCCATCGCCGTCGACGCGACCTACTACCTCAACCACCTGCTCGACACTCCGCCGGCCCACGAGCCCCTCCTCTCC
GCCCTCGGCGGCCTGACCGGCATCCAAACGCACATCATCGAGAACCTCGAGCAGTGGGACAGGAACTGTATCACA
CCTCTTTTCGTCTTCGACGGCCAGTCCATCACAGGCCAGGACCAGGTTTCGCTAAGCCGCCGACGCGCCGCCAAC
CAGAAGACGGACGATGCCTGGAACCTGTATTCGCAGTCCCAGGCCGAGCAGGCCGTGGCCACCTTTGGCGCTAAC
CCCGGTGCCTTTGCCGTCCAGAACCTCTACCCTCTTCTCCAGAGGATCCTGAAGGACCGGGGACTGCACTTCCTG
GTCCCCCCGTACAACGCCTGCGCTCAGCTCGCGTATTACGAGATGATAGACTCGGACCAGTGTGCGGGTGTCATG
GGTCCGCAAGAGCTTCTCCTCTATCCCGTCAAGGACTCCATCATCCGAAGCTTCGACTGGGAAGCCAAGACGGTG
ACGGCCCTGTCCAAGAAGAAGGTGATGCGGGCGCTCGGGGTGGGCGAGCCCATGTTCGTCGACGCCATGCTCATG
ACGGGCACCTCGTTTCTCCCGCCCTTCCCGCCGCTCCAGGACTCGTCCATGTACCCGAACCCCTTCACCATCATG
GACGCGGTCAACATGCTGCGCACGTCTGACAAGTCGATGGCGACGGCCTGCGCCTCCTTCAACGACATACTCCAG
GCGCAGGACCCGGACTGGCTGGACAAGTACCGCAAGGCGCGCATGGCCGTCCACCACTTCATCTTCATCGCGGAG
AACGGCGAGGTGCGGGTCAACGACGCGGAGCGGCTGACCAAGGACAACCACGAGTACCTGGGCCTCCAGCTGCCG
GCGGAGCTGTTCCACTACCTCAACACGGGCCTGATCGGGGCGCGGAATCTGAACTGTATAACGCACGGGCAGATC
GTGGTGCAGCCGACGCTGGACGGCGGGGCGTCGGACGAGTACAGGAAGCTGGTGACGGACAAGATCCTGCCGCTC
AGGGAGCAGGCGCTGGGGCTCATCATCCCGCGGGTGCACCGCGGCATCGGGCACAAGGACATTACGATGCGCGTC
TGGTTCGACGCCAAGTTCGCGCGCACGATCAACCACCGGTCCCTGCAGCCGCCGCCGTCGCAGCAGGTCGGCTCG
TGGGACGTCAAGGAGGCGGACCTGGGCAAGTTCTTCCCGGCCGACTTCGCCGGGCCAATCTACCTGGAGGTGCTG
GCGCTGGCGAACGGCGACTTCGTGGAGCTGACCAAGGCCAAGGACAAGGCGATCCGGGGCATCGACAGCCCGGAG
ATGGTGACGTCGGTGGCCATCTGGCGCTTCCTGCACCTGCGTGGCTACGTCAACGACGAGCACAGGCTGACGCGG
TGGGGGAACGCGCTGGCGACGACGCTGCTGGCGCTCAAGGAGGCCAACGAGGGCCGGCCGGAGGCGCCGGGCGCG
GACGAGGCGGCGCTGCTCGCCTTCGAGCTCATCCGGTTCGGCCTGCTCAACGGCAGGGCGGGCGAGGAGCTGCCC
GGGCTGCCGCGCAAGGGGAGCGAGGAGGAGAAGTCGAGCCTGACGCTCATCAGCCAGGGCGCGACGCTGCTGAAG
CTGAGACACCAGGTCTACGGGTACACGGGCCCTCTGAACAAGAGCCTGCTGGCCTTCCGCTCGCTGTCGTCGGCG
GTGCGGGAGGCGGACCGGGACCTGATCGAGGCGATTGTGGCGTCGATGTTCATGTACGGGCAGTGCAAGAGGGAG
AGGGACGACTACTTGGATATCAGCCAGAGGCTTCCGTTTTTGCAGGAGCCGGACATTGGGCTCGGCATCGCGATC
CGGACCTTCTTCGACGAGGACGAGGCGAGCGACAGCAAAGAGGGGCGGGCGGCCAAGCTGGCCGAGTTCCCCAAG
ACGTTTGTGCCGTTCGCGGAGGCGCTGGCGGACGACTTCCGCCTCTGCACGGACTTTGTCGGGGCCATCAACCAA
GGCGTGCAGACGCTGGACAGCAAGGAGCTGGCGGCGGCGGACAAGGCGGCGTGGGCCAAGGCGCAGGCGTACCTG
GACGCGAGGCCGTTTTGA
Gene >Hirsu2|9208
ATGCCATGTGAGTGGTTTCCCCGTCCGCTCCCCGGGCCAGGCCTGGGCGCTGCCGTCGGCTCGCCCTCTCCTCCC
TTGCAGCGCGTCTCTCGACGCTGCTGCGGGCTTCTACCTGCAGCCGGCAGCTCGACTCTGACCCGCTTGGCCGCT
CGCCGTCGCTCGAGACCTGTCGTTGCCAGACTGCTGCTGGTGGAGTAGGGCGTTCGGCGTTTGCGATGCAGCTTC
TGGCGGCATTCGCACGCCACGGCCCCCCCTCCCTCCAGTGCCTTGCATCCACAAGACGCACACCGAAGACGGAAA
TGCTAACCTGCTCTCGTTGGCAGTCCTTCTGGAGGATTCCTGGATCAATGGCCAGGCCACGTATGTCCACCTCCC
TCCTCCCGTCCACCGCCCGACACTCGCCCCCCGCCTTGGACGCAACGCCCGCCCCTGCTAACCTTGGTTCTCGCC
TCAGAACATACGACGTCGCCGACTTGGAAGACTGCGCCATCGCCGTCGACGCGACCTACTACCTCAACCACCTGC
TCGACACTCCGCCGGCCCACGAGCCCCTCCTCTCCGCCCTCGGCGGCCTGACCGGCATCCAAACGCACATCATCG
AGAACCTCGAGCAGTGGGACAGGAACTGTATCACACCTCTTTTCGTCTTCGACGGCCAGTCCATCACAGGCCAGG
ACCAGGTTTCGCTAAGCCGCCGACGCGCCGCCAACCAGAAGACGGACGATGCCTGGAACCTGTATTCGCAGTCCC
AGGCCGAGCAGGCCGTGGCCACCTTTGGCGCTAACCCCGGTGAGAATCCCTCGCAGCCCGGCGTGCCCAATGTAC
GCGTTGCTGACTCTTCTACTGCCGATGCAAAGGTGCCTTTGCCGTCCAGAACCTCTACCCTCTTCTCCAGAGGAT
CCTGAAGGACCGGGGACTGCACTTCCTGGTCCCCCCGTACAACGCCTGCGCTCAGGTAAGTCTCCCGACCGCGCC
CGACTTGGGAGAGGGGAGGACGGAATGCTGACGCCTGGGGCAGCTCGCGTATTACGAGATGATAGACTCGGACCA
GTGTGCGGGTGTCATGGGTCCGCAAGAGCTTCTCCTCTATCCCGTCAAGGACTCCATCATCCGAAGCTTCGACTG
GGAAGCCAAGACGGTGACGGCCCTGTCCAAGAAGAAGGTGATGCGGGCGCTCGGGGTGGGCGAGCCCATGTTCGT
CGACGCCATGCTCATGACGGGCACCTCGTTTCTCCCGCCCTTCCCGCCGCTCCAGGACTCGTCCATGTACCCGAA
CCCCTTCACCATCATGGACGCGGTCAACATGCTGCGCACGTCTGACAAGTCGATGGCGACGGCCTGCGCCTCCTT
CAACGACATACTCCAGGCGCAGGACCCGGACTGGCTGGACAAGTACCGCAAGGCGCGCATGGCCGTCCACCACTT
CATCTTCATCGCGGAGAACGGCGAGGTGCGGGTCAACGACGCGGAGCGGCTGACCAAGGACAACCACGAGTACCT
GGGCCTCCAGCTGCCGGCGGAGCTGTTCCACTACCTCAACACGGGCCTGATCGGGGCGCGGAATCTGAACTGTAT
AACGCACGGGCAGATCGTGGTGCAGCCGACGCTGGACGGCGGGGCGTCGGACGAGTACAGGAAGCTGGTGACGGA
CAAGATCCTGCCGCTCAGGGAGCAGGCGCTGGGGCTCATCATCCCGCGGGTGCACCGCGGCATCGGGCACAAGGA
CATTACGATGCGCGTCTGGTTCGACGCCAAGTTCGCGCGCACGATCAACCACCGGTCCCTGCAGCCGCCGCCGTC
GCAGCAGGTCGGCTCGTGGGACGTCAAGGAGGCGGACCTGGGCAAGTTCTTCCCGGCCGACTTCGCCGGGCCAAT
CTACCTGGAGGTGCTGGCGCTGGCGAACGGCGACTTCGTGGAGCTGACCAAGGCCAAGGACAAGGCGATCCGGGG
CATCGACAGCCCGGAGATGGTGACGTCGGTGGCCATCTGGCGCTTCCTGCACCTGCGTGGCTACGTCAACGACGA
GCACAGGCTGACGCGGTGGGGGAACGCGCTGGCGACGACGCTGCTGGCGCTCAAGGAGGCCAACGAGGGCCGGCC
GGAGGCGCCGGGCGCGGACGAGGCGGCGCTGCTCGCCTTCGAGCTCATCCGGTTCGGCCTGCTCAACGGCAGGGC
GGGCGAGGAGCTGCCCGGGCTGCCGCGCAAGGGGAGCGAGGAGGAGAAGTCGAGCCTGACGCTCATCAGCCAGGG
CGCGACGCTGCTGAAGCTGAGACACCAGGTCTACGGGTACACGGGCCCTCTGAACAAGAGCCTGCTGGCCTTCCG
CTCGCTGTCGTCGGCGGTGCGGGAGGCGGACCGGGACCTGATCGAGGCGATTGTGGCGTCGATGTTCATGTACGG
GCAGTGCAAGAGGGAGAGGGACGACTACTTGGATATCAGCCAGAGGTGAGTGCAGAGGGGCGCGGTCACGAGGCT
TGAGCTGACGGAGGGGGGGGGCAACGACAGGCTTCCGTTTTTGCAGGAGCCGGACATTGGGCTCGGCATCGCGAT
CCGGACCTTCTTCGACGAGGACGAGGCGAGCGACAGCAAAGAGGGGCGGGCGGCCAAGCTGGCCGAGTTCCCCAA
GACGTTTGTGCCGTTCGCGGAGGCGCTGGCGGACGACTTCCGCCTCTGCACGGACTTTGTCGGGGCCATCAACCA
AGGCGTGCAGACGCTGGACAGCAAGGAGCTGGCGGCGGCGGACAAGGCGGCGTGGGCCAAGGCGCAGGCGTACCT
GGACGCGAGGCCGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail