Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9202
Gene name
LocationContig_652:10220..12777
Strand+
Gene length (bp)2557
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 8.9E-94 27 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P05316|FUR4_YEAST Uracil permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR4 PE=3 SV=2 16 505 4.0E-89
sp|Q04895|DAL4_YEAST Allantoin permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL4 PE=1 SV=1 16 505 4.0E-87
sp|P38196|FUI1_YEAST Uridine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUI1 PE=1 SV=1 18 508 3.0E-85
sp|O14035|YEME_SCHPO Uncharacterized permease C29B12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29B12.14c PE=3 SV=2 18 541 3.0E-80
sp|Q10279|FUR4_SCHPO Uracil permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fur4 PE=1 SV=2 18 505 9.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P05316|FUR4_YEAST Uracil permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR4 PE=3 SV=2 16 505 4.0E-89
sp|Q04895|DAL4_YEAST Allantoin permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL4 PE=1 SV=1 16 505 4.0E-87
sp|P38196|FUI1_YEAST Uridine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUI1 PE=1 SV=1 18 508 3.0E-85
sp|O14035|YEME_SCHPO Uncharacterized permease C29B12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29B12.14c PE=3 SV=2 18 541 3.0E-80
sp|Q10279|FUR4_SCHPO Uracil permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fur4 PE=1 SV=2 18 505 9.0E-79
sp|Q08579|THI72_YEAST Thiamine transporter THI72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI72 PE=2 SV=1 3 506 1.0E-74
sp|Q05998|THI7_YEAST Thiamine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI7 PE=1 SV=1 3 506 7.0E-73
sp|Q08485|NRT1_YEAST Nicotinamide riboside transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRT1 PE=1 SV=1 3 506 6.0E-72
sp|Q9P6J5|YHD5_SCHPO Uncharacterized permease C1683.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.05 PE=3 SV=1 3 521 2.0E-71
sp|Q9LZD0|NCS1_ARATH Purine-uracil permease NCS1 OS=Arabidopsis thaliana GN=NCS1 PE=1 SV=1 11 496 5.0E-49
sp|P94575|ALLP_BACSU Probable allantoin permease OS=Bacillus subtilis (strain 168) GN=pucI PE=2 SV=1 13 504 4.0E-48
sp|P75712|ALLP_ECOLI Putative allantoin permease OS=Escherichia coli (strain K12) GN=ybbW PE=1 SV=2 12 462 2.0E-23
sp|Q01266|YHYC_PSESN Uncharacterized protein in hyuC 3'region (Fragment) OS=Pseudomonas sp. (strain NS671) PE=3 SV=2 25 132 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22
2 63 85 22
3 118 140 22
4 160 182 22
5 189 211 22
6 236 258 22
7 278 300 22
8 397 419 22
9 443 465 22
10 480 499 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9202
MGLSSMLRSIELEHVSSLINEDVRPCDAKRRTWSRLAFHNYWLLINCTIATFLTGSTLIPIGLTWWQAIISIVIG
NLLVTGAILLSSLQGASYHIGFSVYSRAVWGIWGSHFTIWNRIFLSFVWYGFQAWVGGQCVYLILLSWDPQYESR
IGNTLPAETGITSARFVCYVIFSVLSLPFLWIRPHRLQAFFYATSTVTFIFFLVLLIWALATMGPAGFGDTVDGS
QASALPAAGPGSAGWQMVFGAMSTMGSIAAGILNQSDFARLARRPGDAFWGQALAYPVYAIYASVLGILVVAATQ
RRFGGEAIWSPPALFERLLAADDGPGTRAAVFFAGLALIASQLGSSIPGNALAGGIDLASVCPRYIDIRRGAYIT
ALVSPVVNPWRLVTSASIFLSVLSSYGIFLAPMTGMMTANYLILCRRKLKVEDLYRGDAQSIYWYWHGVNWRAFV
AWVIGVAPCLPGFVAQVNTSVKVSDGCIELYYLNYMYGYLVSGLIYTALHRLFPVRAIDDFVQQPTSALELQLYY
REQWDTPSPEASDIGRMLSGSARTETATIAKDPIAAS*
Coding >Hirsu2|9202
ATGGGCTTGTCGTCGATGCTCCGAAGCATCGAGCTGGAGCACGTCTCGTCCTTGATCAACGAAGATGTGCGTCCT
TGCGATGCGAAGAGGCGGACCTGGTCCCGGCTCGCCTTCCACAACTACTGGCTGCTGATCAACTGCACCATCGCG
ACCTTCCTGACGGGCAGCACCCTGATCCCCATCGGCCTGACCTGGTGGCAGGCCATCATCAGCATCGTCATCGGC
AACCTCCTGGTCACGGGGGCCATCCTCCTTAGCTCATTGCAGGGAGCAAGCTATCACATTGGCTTCTCCGTCTAC
AGCCGTGCCGTATGGGGCATCTGGGGGTCTCACTTCACCATCTGGAACCGCATCTTCCTGTCGTTTGTGTGGTAC
GGGTTCCAGGCCTGGGTAGGCGGCCAGTGCGTCTACCTGATCCTCCTGTCGTGGGATCCCCAGTATGAGTCGCGC
ATCGGCAACACGCTGCCGGCCGAGACGGGCATCACGTCGGCCCGGTTCGTGTGCTACGTCATCTTCTCCGTCCTG
AGCCTGCCCTTCCTCTGGATCCGGCCGCATCGGCTGCAGGCCTTCTTCTACGCCACCAGCACCGTCACCTTCATC
TTCTTCCTCGTCCTGCTCATCTGGGCCCTGGCCACCATGGGCCCGGCCGGCTTCGGCGACACCGTCGACGGCAGC
CAGGCCTCGGCGCTACCGGCGGCCGGGCCCGGCAGCGCGGGCTGGCAGATGGTCTTCGGCGCCATGTCGACCATG
GGCTCCATCGCGGCCGGCATCCTCAACCAGAGCGACTTCGCCCGGCTGGCGCGGCGGCCGGGCGACGCCTTCTGG
GGCCAGGCCCTGGCCTACCCCGTCTACGCCATCTACGCCTCCGTGCTCGGCATCCTGGTCGTGGCGGCGACGCAG
CGGCGCTTCGGCGGCGAGGCCATCTGGAGCCCGCCCGCCCTGTTCGAGCGGCTGCTGGCGGCCGACGACGGGCCC
GGCACCCGCGCCGCCGTCTTCTTCGCCGGCCTCGCCCTCATCGCCTCGCAGCTGGGCAGCAGCATCCCCGGCAAC
GCGCTGGCCGGCGGCATCGACCTGGCCTCGGTCTGCCCGCGCTACATCGACATCCGCCGCGGCGCCTACATCACC
GCCCTCGTCAGCCCGGTCGTCAACCCCTGGCGCCTCGTCACCTCGGCCTCCATCTTCCTCAGCGTCCTCAGCAGC
TACGGCATCTTCCTCGCGCCCATGACCGGCATGATGACGGCCAACTACCTCATCCTCTGCCGGCGGAAGCTCAAG
GTCGAGGACCTCTACCGCGGCGACGCCCAGAGCATCTACTGGTACTGGCACGGCGTCAACTGGCGCGCCTTCGTC
GCGTGGGTCATCGGCGTCGCTCCCTGCCTCCCCGGCTTCGTCGCCCAGGTCAACACGTCGGTCAAGGTGAGCGAC
GGCTGCATCGAGCTCTACTACCTCAACTACATGTACGGCTATCTCGTCAGCGGCCTCATCTACACGGCCCTGCAC
CGGCTGTTCCCCGTCAGGGCCATCGACGACTTCGTGCAGCAGCCGACGAGCGCGCTCGAGCTCCAGCTGTACTAC
AGGGAGCAGTGGGACACGCCATCGCCCGAGGCCAGCGACATCGGCCGCATGCTCTCGGGCAGCGCGAGAACCGAG
ACGGCCACGATAGCCAAGGATCCGATCGCGGCCTCCTGA
Transcript >Hirsu2|9202
ATGGGCTTGTCGTCGATGCTCCGAAGCATCGAGCTGGAGCACGTCTCGTCCTTGATCAACGAAGATGTGCGTCCT
TGCGATGCGAAGAGGCGGACCTGGTCCCGGCTCGCCTTCCACAACTACTGGCTGCTGATCAACTGCACCATCGCG
ACCTTCCTGACGGGCAGCACCCTGATCCCCATCGGCCTGACCTGGTGGCAGGCCATCATCAGCATCGTCATCGGC
AACCTCCTGGTCACGGGGGCCATCCTCCTTAGCTCATTGCAGGGAGCAAGCTATCACATTGGCTTCTCCGTCTAC
AGCCGTGCCGTATGGGGCATCTGGGGGTCTCACTTCACCATCTGGAACCGCATCTTCCTGTCGTTTGTGTGGTAC
GGGTTCCAGGCCTGGGTAGGCGGCCAGTGCGTCTACCTGATCCTCCTGTCGTGGGATCCCCAGTATGAGTCGCGC
ATCGGCAACACGCTGCCGGCCGAGACGGGCATCACGTCGGCCCGGTTCGTGTGCTACGTCATCTTCTCCGTCCTG
AGCCTGCCCTTCCTCTGGATCCGGCCGCATCGGCTGCAGGCCTTCTTCTACGCCACCAGCACCGTCACCTTCATC
TTCTTCCTCGTCCTGCTCATCTGGGCCCTGGCCACCATGGGCCCGGCCGGCTTCGGCGACACCGTCGACGGCAGC
CAGGCCTCGGCGCTACCGGCGGCCGGGCCCGGCAGCGCGGGCTGGCAGATGGTCTTCGGCGCCATGTCGACCATG
GGCTCCATCGCGGCCGGCATCCTCAACCAGAGCGACTTCGCCCGGCTGGCGCGGCGGCCGGGCGACGCCTTCTGG
GGCCAGGCCCTGGCCTACCCCGTCTACGCCATCTACGCCTCCGTGCTCGGCATCCTGGTCGTGGCGGCGACGCAG
CGGCGCTTCGGCGGCGAGGCCATCTGGAGCCCGCCCGCCCTGTTCGAGCGGCTGCTGGCGGCCGACGACGGGCCC
GGCACCCGCGCCGCCGTCTTCTTCGCCGGCCTCGCCCTCATCGCCTCGCAGCTGGGCAGCAGCATCCCCGGCAAC
GCGCTGGCCGGCGGCATCGACCTGGCCTCGGTCTGCCCGCGCTACATCGACATCCGCCGCGGCGCCTACATCACC
GCCCTCGTCAGCCCGGTCGTCAACCCCTGGCGCCTCGTCACCTCGGCCTCCATCTTCCTCAGCGTCCTCAGCAGC
TACGGCATCTTCCTCGCGCCCATGACCGGCATGATGACGGCCAACTACCTCATCCTCTGCCGGCGGAAGCTCAAG
GTCGAGGACCTCTACCGCGGCGACGCCCAGAGCATCTACTGGTACTGGCACGGCGTCAACTGGCGCGCCTTCGTC
GCGTGGGTCATCGGCGTCGCTCCCTGCCTCCCCGGCTTCGTCGCCCAGGTCAACACGTCGGTCAAGGTGAGCGAC
GGCTGCATCGAGCTCTACTACCTCAACTACATGTACGGCTATCTCGTCAGCGGCCTCATCTACACGGCCCTGCAC
CGGCTGTTCCCCGTCAGGGCCATCGACGACTTCGTGCAGCAGCCGACGAGCGCGCTCGAGCTCCAGCTGTACTAC
AGGGAGCAGTGGGACACGCCATCGCCCGAGGCCAGCGACATCGGCCGCATGCTCTCGGGCAGCGCGAGAACCGAG
ACGGCCACGATAGCCAAGGATCCGATCGCGGCCTCCTGA
Gene >Hirsu2|9202
ATGGGCTTGTCGTCGATGCTCCGAAGCATCGAGCTGGAGCACGTCTCGTCCTTGATCGTCCGTCTGCCCCTGTTC
CGTTTCCTGCTTGGGGGAAAAGGGGGGGGGGGGGGGAAGAGGTTTCGTCACAACTGACGGGCTTGGCTGACGCTT
TGCTGCGGCGGCCGTGACAGAACGAAGATGTGCGTCCTTGCGATGCGAAGAGGCGGACCTGGTCCCGGCTCGCCT
TCCACAACTACTGTGCGTTTGCGCGTCTCGAGGCCGACGTCGGCTTTCGATGCTTCCGGCCACGTTCCCCGGCTG
ACTCTCTCTCGCTCTGTCGAGCAGGGCTGCTGATCAACTGCACCATCGCGACCTTCCTGACGGGCAGCACCCTGA
TCCCCATCGGCCTGACCTGGTGGCAGGCCATCATCAGTACGGCCGGCCACCCGACGCTCAGGGGCGCCCTGCTCG
GCCAATGCGCCCGAAGGCTAATCCCGGACGAACAGGCATCGTCATCGGCAACCTCCTGGTCACGGGGGCCATCCT
CCTTAGCTCATTGCAGGGAGCAAGCTATCACAGTACTGCGCCCTCTGTCCCCGCTGCCCAGCTCCTGGGCCCCCC
TCCCCTCCCCCTCCCCTGTCCTCCTCTTCGCACCTCATCCGCCTGCGCTTTCTGCCCCGTCTCCGGTCTCTCACT
CTTTGGCGCCCTTTCGCCATGATGAAGACGGAGAGGGCGTGAGGGAAGCGGGAAGAAGGCCTCGGCCGCCCCGAG
GAGAGATTGAAGGGCGCGACAGCAAGCTGACCTGATTCCTCGTCCCTCGTCCCAAGTTGGCTTCTCCGTCTACAG
CCGTGCCGTATGGGGCATCTGGGGGTCTCACTTCACCATCTGGAACCGCATCTTCCTGTCGTTTGGTGCGTCACC
CGTCCTGCCGCGAAGAACAACGTTCCGTTGTCGATGGGAAAGCTGACCGCGGACGGACGATATACGATTCCAGTG
TGGTAAGTAAGTCCCGGACGGCGTATTGCCTCCCGCCTCCTCCCGACCCGATGGATCCTCCCCCTGCCCCCTTTC
CTCTCGAGGTTTACCGATGGGGCGGCGAACGAGATACAGACGAGAGACGGGCATGGACTGATGATGGTATGCATG
CGCGTGTAGGTACGGGTTCCAGGCCTGGGTAGGCGGCCAGTGCGTCTACCTGATCCTCCTGTCGTGGGATCCCCA
GTATGAGTCGCGCATCGGCAACACGCTGCCGGCCGAGACGGGCATCACGTCGGCCCGGTTCGTGTGCTACGTCAT
CTTCTCCGTCCTGAGCCTGCCCTTCCTCTGGATCCGGCCGCATCGGCTGCAGGCCTTCTTCTACGCCACCAGCAC
CGTCACCTTCATCTTCTTCCTCGTCCTGCTCATCTGGGCCCTGGCCACCATGGGCCCGGCCGGCTTCGGCGACAC
CGTCGACGGCAGCCAGGCCTCGGCGCTACCGGCGGCCGGGCCCGGCAGCGCGGGCTGGCAGATGGTCTTCGGCGC
CATGTCGACCATGGGCTCCATCGCGGCCGGCATCCTCAACCAGAGCGACTTCGCCCGGCTGGCGCGGCGGCCGGG
CGACGCCTTCTGGGGCCAGGCCCTGGCCTACCCCGTCTACGCCATCTACGCCTCCGTGCTCGGCATCCTGGTCGT
GGCGGCGACGCAGCGGCGCTTCGGCGGCGAGGCCATCTGGAGCCCGCCCGCCCTGTTCGAGCGGCTGCTGGCGGC
CGACGACGGGCCCGGCACCCGCGCCGCCGTCTTCTTCGCCGGCCTCGCCCTCATCGCCTCGCAGCTGGGCAGCAG
CATCCCCGGCAACGCGCTGGCCGGCGGCATCGACCTGGCCTCGGTCTGCCCGCGCTACATCGACATCCGCCGCGG
CGCCTACATCACCGCCCTCGTCAGCCCGGTCGTCAACCCCTGGCGCCTCGTCACCTCGGCCTCCATCTTCCTCAG
CGTCCTCAGCAGCTACGGCATCTTCCTCGCGCCCATGACCGGCATGATGACGGCCAACTACCTCATCCTCTGCCG
GCGGAAGCTCAAGGTCGAGGACCTCTACCGCGGCGACGCCCAGAGCATCTACTGGTACTGGCACGGCGTCAACTG
GCGCGCCTTCGTCGCGGTACGCGAATCTGCTTCCTCTCTCTCTTCTCCCCTCTCTGCCTCATCTCCCCCCTTCTC
ATACGCTTCTGTCCGCTGCTTTTCTTCTTCTGACAAAAGGCCGTAGTGGGTCATCGGCGTCGCTCCCTGCCTCCC
CGGCTTCGTCGCCCAGGTCAACACGTCGGTCAAGGTGAGCGACGGCTGCATCGAGCTCTACTACCTCAACTACAT
GTACGGCTATCTCGTCAGCGGCCTCATCTACACGGCCCTGCACCGGCTGTTCCCCGTCAGGGCCATCGACGACTT
CGTGCAGCAGCCGACGAGCGCGCTCGAGCTCCAGCTGTACTACAGGGAGCAGTGGGACACGCCATCGCCCGAGGC
CAGCGACATCGGCCGCATGCTCTCGGGCAGCGCGAGAACCGAGACGGCCACGATAGCCAAGGATCCGATCGCGGC
CTCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail