Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9187
Gene name
LocationContig_65:35335..41746
Strand+
Gene length (bp)6411
Transcript length (bp)5964
Coding sequence length (bp)5964
Protein length (aa) 1988

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 6.9E-59 1601 1776
PF14765 PS-DH Polyketide synthase dehydratase 4.8E-56 412 695
PF00698 Acyl_transf_1 Acyl transferase domain 3.8E-54 39 355
PF08242 Methyltransf_12 Methyltransferase domain 4.3E-21 888 993
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 4.9E-16 1448 1576
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 4.8E-13 1402 1493
PF13649 Methyltransf_25 Methyltransferase domain 4.0E-11 887 991
PF13489 Methyltransf_23 Methyltransferase domain 4.5E-11 877 1046
PF08241 Methyltransf_11 Methyltransferase domain 7.5E-10 888 994
PF13847 Methyltransf_31 Methyltransferase domain 7.5E-10 883 999
PF00106 adh_short short chain dehydrogenase 1.9E-07 1604 1758
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.3E-06 873 1001

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 28 1979 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 30 1073 4.0E-110
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 30 1073 3.0E-108
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 36 1185 8.0E-107
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1256 1952 3.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 28 1979 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 30 1073 4.0E-110
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 30 1073 3.0E-108
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 36 1185 8.0E-107
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1256 1952 3.0E-81
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1256 1952 3.0E-81
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1176 1949 2.0E-64
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1265 1779 1.0E-63
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 29 651 2.0E-63
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1265 1781 2.0E-62
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1265 1801 9.0E-59
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1239 1779 1.0E-58
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1255 1787 2.0E-58
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1345 1841 5.0E-58
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 850 1954 3.0E-57
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1284 1814 3.0E-57
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 880 1984 4.0E-57
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1294 1789 4.0E-56
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1295 1765 4.0E-55
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1295 1765 1.0E-54
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1295 1782 2.0E-54
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 885 1814 2.0E-53
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 929 1779 6.0E-52
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1271 1949 6.0E-51
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1269 1781 9.0E-51
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1269 1781 1.0E-50
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1269 1781 1.0E-50
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1269 1781 1.0E-50
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1269 1781 1.0E-50
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1285 1779 7.0E-49
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1280 1980 2.0E-47
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1225 1954 6.0E-45
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1219 1954 6.0E-44
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1219 1954 8.0E-44
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1269 1786 1.0E-43
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1285 1794 2.0E-43
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1219 1954 2.0E-43
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1280 1951 4.0E-43
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1219 1954 5.0E-43
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1219 1954 5.0E-43
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1273 1951 3.0E-42
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1271 1981 9.0E-42
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1219 1954 1.0E-41
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1275 1782 1.0E-41
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1219 1954 4.0E-41
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1273 1981 7.0E-41
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1273 1979 5.0E-40
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1275 1782 7.0E-40
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1271 1786 2.0E-39
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1271 1986 8.0E-39
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 33 621 1.0E-38
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 33 621 1.0E-38
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 33 621 1.0E-38
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 37 463 2.0E-38
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1271 1981 2.0E-38
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1271 1782 2.0E-38
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1595 1977 4.0E-38
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1271 1982 2.0E-37
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 35 395 9.0E-37
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 37 627 1.0E-36
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1271 1983 1.0E-36
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 6 664 3.0E-36
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 6 651 4.0E-36
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1225 1786 6.0E-36
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1271 1982 7.0E-36
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 20 621 1.0E-35
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1280 1771 2.0E-35
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1271 1819 3.0E-35
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 37 627 4.0E-35
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 6 651 7.0E-35
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1280 1771 3.0E-34
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1249 1578 2.0E-33
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1 402 3.0E-33
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 34 487 5.0E-33
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 36 395 1.0E-31
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 39 629 2.0E-31
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 37 464 2.0E-31
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 36 395 2.0E-31
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 37 498 1.0E-30
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 37 491 4.0E-30
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 34 487 4.0E-30
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 34 487 5.0E-30
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 37 461 5.0E-30
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 37 461 5.0E-30
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 37 533 1.0E-29
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 37 458 2.0E-29
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1284 1581 9.0E-29
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 34 371 1.0E-28
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 41 647 2.0E-28
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 41 647 2.0E-28
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 41 647 2.0E-28
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 41 647 2.0E-28
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 39 458 3.0E-28
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 39 467 3.0E-28
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 39 458 5.0E-28
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 39 645 6.0E-28
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 41 647 7.0E-28
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 36 395 8.0E-28
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 17 515 1.0E-27
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 36 402 1.0E-27
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 38 640 2.0E-27
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 17 515 2.0E-27
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 17 515 3.0E-27
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1577 1977 5.0E-27
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 39 458 6.0E-27
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1577 1977 7.0E-27
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 17 515 2.0E-26
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 38 638 3.0E-26
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 38 458 4.0E-26
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 8 502 5.0E-26
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 36 483 5.0E-26
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 17 515 2.0E-25
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 17 501 2.0E-25
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 20 504 2.0E-25
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 37 458 3.0E-25
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 17 515 4.0E-25
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 17 489 4.0E-25
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 17 515 4.0E-25
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 38 477 4.0E-25
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 38 489 5.0E-25
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 39 458 7.0E-25
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 37 458 3.0E-24
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 37 458 9.0E-24
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1283 1498 1.0E-23
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1284 1581 2.0E-23
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 30 489 5.0E-23
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 36 502 5.0E-23
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1284 1581 5.0E-23
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 38 458 6.0E-23
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1283 1498 9.0E-23
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 38 459 1.0E-22
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 36 394 4.0E-22
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 37 458 4.0E-22
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1257 1590 6.0E-22
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1257 1590 6.0E-22
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1283 1498 7.0E-22
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1263 1493 7.0E-22
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 27 621 1.0E-21
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 27 621 1.0E-21
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1283 1498 1.0E-21
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1281 1562 6.0E-21
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 36 502 2.0E-20
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 36 397 2.0E-20
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 36 397 2.0E-20
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 36 397 2.0E-20
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 37 402 3.0E-20
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1279 1574 3.0E-20
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1283 1498 4.0E-20
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1281 1562 8.0E-20
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 36 420 1.0E-19
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1284 1580 7.0E-19
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1281 1498 2.0E-18
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1599 1763 5.0E-18
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1277 1492 8.0E-18
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1263 1492 1.0E-17
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1256 1493 1.0E-17
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1619 1790 2.0E-17
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1586 1764 3.0E-17
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 36 328 3.0E-17
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 34 399 3.0E-17
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1618 1779 1.0E-16
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1260 1482 1.0E-16
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1618 1779 2.0E-16
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1618 1779 2.0E-16
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 37 358 4.0E-16
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 876 1073 6.0E-16
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 37 328 2.0E-15
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1599 1763 2.0E-15
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1277 1492 2.0E-15
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 876 1045 3.0E-15
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1601 1969 3.0E-15
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1601 1969 4.0E-15
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1601 1969 4.0E-15
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1616 1815 1.0E-14
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 37 373 1.0E-14
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 33 351 2.0E-14
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 33 351 3.0E-14
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 33 403 3.0E-14
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 33 403 3.0E-14
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 33 403 3.0E-14
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 33 351 4.0E-14
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 35 328 5.0E-14
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 884 1045 1.0E-13
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1277 1492 1.0E-13
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 37 277 2.0E-13
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1582 1786 3.0E-13
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1599 1945 3.0E-13
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1598 1762 3.0E-13
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1602 1822 4.0E-13
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 850 1046 5.0E-13
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 37 355 7.0E-13
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 850 1046 8.0E-13
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1290 1585 1.0E-12
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1618 1782 2.0E-12
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1618 1782 2.0E-12
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1274 1492 3.0E-12
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1561 1773 4.0E-12
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1561 1773 4.0E-12
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1561 1773 4.0E-12
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 37 272 7.0E-12
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1279 1492 8.0E-12
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1597 1763 2.0E-11
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1259 1492 2.0E-11
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 1290 1580 4.0E-11
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 850 1101 5.0E-11
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 880 1059 5.0E-11
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1602 1764 9.0E-11
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 885 1101 1.0E-10
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 850 1045 1.0E-10
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 808 1075 2.0E-10
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 880 1036 2.0E-10
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 850 1018 3.0E-10
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1604 1758 3.0E-10
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 885 1018 4.0E-10
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 850 1075 5.0E-10
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 850 1018 1.0E-09
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1290 1580 3.0E-09
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 888 1045 5.0E-09
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 880 1018 6.0E-09
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 888 1051 7.0E-09
sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 1360 1576 1.0E-08
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1293 1493 2.0E-08
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 36 248 2.0E-08
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 888 1045 3.0E-08
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1589 1773 4.0E-08
sp|Q9BV79|MECR_HUMAN Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 1257 1492 4.0E-08
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 1577 1751 5.0E-08
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1277 1492 6.0E-08
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 1360 1578 6.0E-08
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 789 1040 7.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1597 1758 7.0E-08
sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 1236 1422 7.0E-08
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 888 1045 8.0E-08
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1284 1575 1.0E-07
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1284 1495 2.0E-07
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 36 328 2.0E-07
sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 1257 1492 6.0E-07
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 36 328 7.0E-07
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 36 328 7.0E-07
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 36 328 7.0E-07
sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 1593 1750 9.0E-07
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 1600 1751 9.0E-07
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 1600 1751 9.0E-07
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 1600 1751 9.0E-07
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 1600 1751 9.0E-07
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 1600 1751 9.0E-07
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 1600 1751 9.0E-07
sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=1 SV=2 1360 1576 1.0E-06
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 36 328 1.0E-06
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 36 328 1.0E-06
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 36 328 1.0E-06
sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 1360 1576 1.0E-06
sp|Q8K9J6|FABD_BUCAP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabD PE=3 SV=1 38 327 1.0E-06
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 1599 1749 2.0E-06
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 1307 1576 5.0E-06
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 1599 1756 6.0E-06
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 1605 1756 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9187
MGLGRAHLAYRSFSIVGDGAVETLTFSPFEKVGTGKVAFAFTGQGAQWEGMARSLIHASPSFRRDIREMDAALRS
LSEWTIEDLLSSGIDGEQDYINKTEFAQPLCTAVQIAVVNFLARCGITPCAVVGHSSGEIAAAYAAGALTASEAI
VFAFARGQATRLKGRTGLMAAVGLGRNAVLPHLAEGAIIACENSAQSVTVSGDPEAVRQTLETIKAEVPDTFARL
LHVNVAYHSHHMRDVGAKYEELLAPYAKEGRETGMPAVPFFSSVYGKALPAETRLDRTYWRKNLESPVLFLAAAS
SLLTGVPDVATVLEIGPHSALRGPLRQIFQERNPKRGPSYVPTLVRNNDCISSILDTVGQLYVRGHAVDFSFLNS
ATSMLVDLPNYPWDHSEEYWKESRVSEAWRMKGHRHHEVLGDKCAVASSLEPVWRNVFHHSDVPWLADHKVETNV
VFPCAGYVAVMGEAVRQALCSNGYELRNLTVKAALVLPETEVVEMMTTMRPARLTDLTNSPSWHDICISTFNGTA
WTENCTAQGRAAGGDGGWPGETGPRLTGPYSRQIPKSYFYDRVRHLGLRLGPRFQGMTDISADTERQAAAAAFRD
DAAEYEAPYAAHPTTIDCCLQLCIVSSCRGVARNMDTLALPIGIRRVVVIPGKEPDLVASAETDPASATASAVAL
AKDSRRPIIVLENARCIPFDTGDDSDGRDSLTSARLEWLPDIDCLPSTDDLIWRGDGRRKQHLASERLTSLGILQ
TLHVLKSLEVSPSGHLAKYVAWLEEEKQAMVSGDRPLALPEEREWASMEPSALKLLASSALEELEALGDGTVTSV
GRMLYDMAQQEAIEPIFGRGANPEQPIVAGGRINDLYTSLQTPANAAEFFRLCGHAKPTMKVLEIGAGTGSTTEQ
ILNSLVSDDDIRLYGQYIFTDISSSFFTDASKRFEDRGGMAYKALDITKSPAEQGFELGSFDLVVAANVLHATPS
LQESLQNVRSLLRPDGRLYLVELAKPLAWRTVGFVAGRLPGWWLGEEDGRADVPFVSVDRWDAELRAAGFSGAES
SVLDDEAPYSTSAHITSRVAAALPQPEAVTILYREARHELACSLADALAADGVAVHWARLGSGEGLDNVQHVIAA
VDLERPFFDDIAEPDYQAFMALLAGLKGGILWLTGSAQIACTDPRYGLVNGVARTARVELSVDFWTAELQRPDAS
ALKAIMAIARKFFGRAPLSRGTDTEFAVHDGMVRTARCHWTSLTGALEPEADDGGARQMVIGQYGAIDSLHWVRS
DPGSLQAHEVEVDIRCVGLNFRDNMVAMGLLPMPKDKLGFEAGAVVCRVGSAVDHVAVGDRVCVLNTGLFATRKV
VAGHCVFRIPDNLTLADAATVPVVYGTAIAVLIYQGQLQRGQSVLIHSAAGGVGQAAINICQMLGAEIFATVGSE
KKAGFLVENYGIVRERIFNSRSASFLDDVMRATQDRGVDIVLNALSGDLLHASWKCVAKGGKMMEIGKRDILERG
RLDLDGFQDNRSFHSFDLHYLLKEQPDVCTDILRRSWEWASEGHIKPIQPIHEYPVQNLPDAVRFMRTGEHIGKI
VATIPGNPASIPATNVAGPGLLSDTSTYLLVGGLGGLGKAVTRWLVERGARSLCFLSRSAGASEQDQVFFRELES
QGCRVATVAGSVADMADVRKAVEAAPTLIGGVLQLSMVLRDRAFLQMSYDDWRAAQEPKVRGTWNLHTALAETKL
DFFILLSSISGTVGQPGQANYASANSFLDSFVQYRHGLGLPCSVIDLGAMEGIGYLSDKRARLDQYKSFGAHVLQ
ERHLVDAIQLAMKRSVPTNDTDPASPRGPLTNMSQLIVGLTSTKAPSDPTNRTAFRHDVRVGIYNNMVTGSEATA
LSKDQGMSRLVSQFEANPGLLADPDAVSQVSLELGRLLFRLLLLPEETLDTSMSLASIGIDSLASIEIRNWWRKT
LGDDKSVLDIMSAGTIEGLGRLAVVSLQKKHGVGVEA*
Coding >Hirsu2|9187
ATGGGGCTCGGCAGAGCCCATCTGGCCTACCGGAGCTTCTCCATCGTCGGAGACGGCGCGGTCGAGACGCTAACG
TTCAGTCCCTTCGAGAAGGTCGGCACCGGCAAAGTCGCCTTCGCCTTCACAGGTCAAGGCGCCCAGTGGGAGGGC
ATGGCGAGGAGCCTCATCCACGCCTCTCCGTCCTTCCGCAGGGACATTCGGGAGATGGACGCCGCGCTGCGTAGC
CTGAGCGAATGGACGATCGAAGACCTCCTCAGCTCCGGCATCGACGGTGAGCAGGACTATATCAACAAGACCGAG
TTCGCACAGCCTCTCTGCACGGCTGTCCAGATCGCCGTGGTGAACTTCCTGGCCAGGTGCGGCATAACCCCCTGT
GCCGTTGTCGGCCACTCCAGCGGGGAGATTGCGGCCGCCTATGCCGCCGGAGCCCTGACGGCGTCCGAGGCCATC
GTCTTCGCCTTTGCTCGCGGGCAGGCGACGCGGCTCAAAGGCCGGACGGGCCTCATGGCGGCCGTCGGGCTGGGC
CGCAACGCCGTCCTGCCGCATCTCGCTGAGGGCGCAATCATCGCCTGTGAGAATAGCGCGCAGAGCGTGACCGTA
TCGGGCGACCCGGAGGCCGTCAGACAGACGCTGGAGACGATCAAGGCCGAGGTTCCCGACACATTCGCCCGCCTC
CTCCACGTCAACGTGGCCTATCACTCGCACCACATGCGTGATGTTGGCGCCAAGTACGAAGAGCTGTTGGCGCCC
TATGCAAAGGAAGGCAGGGAGACGGGCATGCCGGCCGTGCCCTTTTTCTCGAGCGTCTACGGCAAAGCCCTCCCC
GCCGAGACTCGGCTCGACCGGACGTACTGGCGGAAGAATCTCGAGTCGCCCGTCTTGTTCCTCGCGGCCGCTTCC
AGTCTGCTGACCGGCGTGCCGGACGTGGCCACAGTGCTCGAGATCGGCCCCCATTCCGCCCTCCGCGGGCCACTT
CGCCAGATCTTCCAGGAACGGAACCCCAAGAGGGGGCCATCATACGTGCCAACCCTGGTTCGGAACAACGACTGC
ATCAGCTCGATTCTGGATACCGTCGGTCAGCTGTATGTGCGTGGCCACGCCGTTGACTTCTCCTTTCTCAACTCG
GCGACATCGATGCTGGTCGACCTGCCCAACTACCCTTGGGACCACAGTGAGGAGTACTGGAAGGAGAGCCGTGTG
TCGGAGGCATGGCGAATGAAGGGACACAGACACCACGAGGTTCTCGGCGACAAATGCGCGGTAGCTTCCAGTCTT
GAGCCCGTTTGGCGGAACGTGTTCCACCACTCCGACGTCCCCTGGCTCGCGGATCACAAGGTCGAGACGAATGTC
GTCTTTCCGTGCGCCGGCTACGTCGCCGTGATGGGTGAGGCTGTCCGGCAGGCCCTATGCTCCAACGGCTATGAG
CTGCGGAACCTGACAGTCAAGGCGGCCCTGGTGCTGCCCGAGACCGAAGTCGTCGAGATGATGACGACGATGCGA
CCCGCGCGCCTGACCGACCTGACCAACTCGCCGTCCTGGCACGATATATGCATCTCCACCTTCAACGGGACGGCC
TGGACGGAGAACTGCACTGCCCAGGGCAGGGCGGCCGGGGGGGACGGGGGCTGGCCGGGGGAGACGGGTCCTCGG
CTCACGGGCCCCTATTCGCGGCAGATACCCAAGAGCTATTTCTATGACCGCGTGCGCCATCTCGGCCTGAGATTA
GGCCCGCGCTTCCAGGGCATGACGGACATCTCGGCCGATACGGAGCGGCAGGCGGCGGCGGCGGCGTTTCGCGAT
GACGCGGCCGAGTACGAGGCGCCGTACGCCGCCCATCCCACGACCATCGACTGCTGTCTTCAGCTCTGCATCGTG
TCCAGCTGCCGCGGAGTGGCCCGCAACATGGACACGTTAGCCCTCCCGATCGGCATCCGGCGCGTCGTCGTAATC
CCCGGCAAAGAGCCAGACCTTGTGGCATCGGCCGAGACGGACCCGGCCAGCGCGACAGCAAGCGCCGTCGCGCTC
GCCAAGGACAGCCGGCGCCCCATTATCGTGCTCGAGAACGCCAGATGCATCCCGTTCGACACCGGAGACGACTCG
GACGGCCGCGACAGCCTCACCTCGGCGCGCCTTGAGTGGCTCCCCGACATCGACTGCCTCCCGTCTACGGACGAC
CTGATCTGGCGCGGGGACGGCAGGCGGAAGCAGCACCTGGCCAGCGAGAGGCTCACGTCGCTGGGGATCCTGCAG
ACGCTCCACGTGTTGAAGTCGCTCGAGGTGTCGCCCTCGGGCCACCTGGCCAAGTACGTCGCCTGGCTGGAGGAG
GAGAAGCAGGCCATGGTAAGCGGCGACAGGCCCCTCGCGTTGCCCGAAGAGCGGGAATGGGCGTCGATGGAGCCC
AGCGCGCTGAAGCTTCTCGCCAGCTCGGCGCTGGAGGAGCTCGAGGCCCTCGGCGACGGCACGGTCACCAGCGTG
GGCCGGATGCTGTACGACATGGCGCAGCAGGAGGCCATCGAGCCCATCTTCGGACGAGGCGCGAACCCTGAGCAG
CCCATCGTGGCCGGCGGGCGCATCAACGACCTCTACACGTCCCTGCAAACGCCAGCCAACGCGGCCGAGTTCTTC
CGTCTCTGCGGCCACGCCAAGCCGACGATGAAGGTGCTGGAGATCGGTGCCGGCACCGGCAGCACCACCGAGCAG
ATCCTGAACTCGCTCGTGTCCGACGACGACATCCGACTGTACGGACAGTACATCTTCACGGACATCTCGTCCTCC
TTTTTCACCGACGCCAGCAAGCGCTTCGAGGACCGGGGCGGCATGGCGTACAAGGCCCTGGACATCACAAAGAGC
CCGGCCGAGCAGGGTTTCGAGCTCGGCTCCTTCGATCTCGTCGTTGCCGCCAACGTGCTGCACGCCACGCCCTCG
CTACAGGAGAGCCTGCAGAACGTCCGGTCGCTGCTCCGGCCCGACGGCCGCCTGTATCTCGTCGAGCTGGCCAAG
CCGCTCGCGTGGCGGACCGTAGGCTTTGTTGCCGGCCGGCTTCCTGGGTGGTGGCTGGGAGAGGAGGACGGCCGG
GCCGACGTGCCCTTCGTCTCTGTCGACCGATGGGACGCCGAGCTCCGGGCTGCGGGTTTCTCCGGCGCCGAGTCC
TCCGTGCTCGACGACGAGGCGCCGTACAGCACGTCCGCCCATATCACGAGCAGAGTCGCTGCGGCGCTTCCCCAG
CCGGAAGCCGTGACGATCCTGTACCGAGAGGCCAGGCATGAGCTGGCCTGTAGCCTGGCCGACGCCTTGGCTGCA
GACGGTGTCGCCGTCCACTGGGCGCGGCTCGGCAGCGGCGAGGGTCTTGATAACGTGCAGCACGTGATCGCAGCC
GTCGACCTGGAGCGCCCCTTCTTCGACGACATCGCCGAGCCTGACTACCAGGCCTTCATGGCCCTCCTCGCCGGC
CTCAAGGGCGGCATCCTGTGGCTCACCGGCTCTGCCCAGATCGCCTGTACCGACCCTCGCTATGGCTTGGTCAAC
GGGGTGGCCCGGACGGCGCGGGTCGAGCTGTCTGTCGACTTCTGGACGGCGGAGCTGCAGAGGCCGGACGCGTCG
GCCTTGAAGGCCATCATGGCCATCGCCCGCAAGTTCTTCGGCCGCGCGCCTCTGAGCCGAGGCACCGATACCGAG
TTCGCCGTCCACGACGGCATGGTCCGCACCGCCCGCTGCCACTGGACCTCGCTGACCGGTGCCCTGGAGCCTGAG
GCGGACGACGGCGGCGCGAGGCAGATGGTCATCGGTCAGTACGGCGCGATCGACTCGTTGCACTGGGTCCGGTCC
GATCCGGGCTCGCTCCAGGCTCATGAAGTCGAGGTCGACATCCGGTGCGTTGGGCTTAACTTCAGGGACAATATG
GTCGCCATGGGCCTGTTGCCGATGCCCAAGGACAAGCTCGGGTTTGAGGCTGGCGCAGTCGTTTGCCGCGTGGGA
TCGGCCGTCGACCACGTCGCTGTGGGCGATCGCGTCTGTGTCCTGAACACTGGCCTCTTCGCGACCCGCAAGGTC
GTTGCGGGACACTGCGTCTTCCGTATACCGGACAACTTGACGTTGGCAGACGCTGCTACCGTCCCCGTCGTCTAC
GGAACTGCGATAGCCGTCTTGATCTACCAGGGACAGCTGCAGCGAGGCCAGTCTGTCTTGATACACTCTGCCGCC
GGTGGAGTCGGGCAGGCGGCTATCAACATCTGCCAGATGCTGGGTGCCGAGATCTTCGCGACAGTGGGAAGTGAA
AAGAAGGCCGGATTTCTCGTCGAAAACTACGGCATCGTGCGCGAGAGGATATTCAACTCCCGCAGCGCTTCGTTC
CTGGACGACGTCATGCGGGCTACGCAGGACCGAGGTGTTGATATCGTCCTGAACGCCCTATCCGGTGATCTGCTG
CACGCCTCCTGGAAGTGCGTCGCCAAGGGTGGCAAGATGATGGAGATCGGCAAGCGAGATATCCTCGAGCGCGGC
CGCCTGGATCTCGACGGCTTCCAGGACAACCGGTCCTTCCACAGCTTTGACCTGCACTACCTGCTCAAGGAGCAA
CCCGATGTCTGCACCGACATCTTGCGCCGGTCCTGGGAATGGGCGAGCGAGGGCCATATCAAGCCCATCCAGCCG
ATCCACGAATACCCGGTCCAAAATCTGCCGGACGCCGTGCGGTTCATGAGGACAGGCGAGCATATCGGCAAGATC
GTCGCCACGATTCCTGGTAATCCGGCTAGTATTCCGGCCACAAACGTTGCCGGGCCGGGCCTGCTATCGGACACG
TCGACCTATCTCCTAGTCGGCGGCCTAGGCGGCCTAGGCAAGGCCGTGACCCGCTGGCTGGTGGAGAGGGGCGCT
CGAAGCCTATGCTTCCTCTCTCGCTCGGCCGGCGCGTCGGAGCAGGACCAGGTCTTCTTTAGGGAGCTCGAGTCG
CAGGGCTGCCGCGTGGCGACTGTAGCTGGCAGTGTCGCGGACATGGCCGACGTCCGGAAGGCCGTCGAGGCCGCG
CCGACGCTCATCGGCGGCGTGCTGCAACTGTCCATGGTCCTTCGGGACCGAGCCTTCCTCCAGATGAGCTACGAC
GACTGGAGAGCAGCGCAAGAACCCAAGGTCAGGGGCACGTGGAATCTTCACACGGCCCTTGCCGAGACGAAGCTC
GACTTCTTCATTCTTCTGTCCTCGATCTCGGGCACCGTCGGTCAGCCGGGACAGGCCAATTACGCCTCGGCCAAC
TCTTTTCTCGACTCGTTCGTCCAGTATCGCCACGGCCTCGGCCTGCCCTGTTCGGTGATTGACCTGGGCGCGATG
GAGGGCATCGGCTACCTGAGCGACAAGCGGGCCAGGCTGGACCAGTACAAGTCGTTTGGCGCGCACGTGCTGCAG
GAGCGGCACCTCGTCGACGCGATCCAGCTGGCCATGAAGCGTTCCGTACCGACCAACGACACCGACCCGGCCAGC
CCGCGAGGTCCGTTGACGAATATGAGCCAGCTCATCGTCGGCTTGACCTCGACCAAGGCGCCATCGGATCCGACG
AATCGCACCGCCTTCAGACATGACGTCCGCGTCGGCATTTACAACAACATGGTGACTGGCAGCGAGGCGACGGCC
CTGTCGAAAGATCAGGGGATGAGTCGGCTCGTCAGCCAGTTTGAGGCCAACCCGGGACTCCTTGCCGATCCGGAC
GCCGTGAGCCAGGTGTCGCTGGAGCTCGGCCGGCTTTTGTTCCGGCTCCTGCTGCTCCCGGAGGAGACGCTGGAC
ACGAGCATGTCGCTCGCCTCTATCGGAATCGACTCGCTGGCAAGTATCGAGATCCGCAACTGGTGGCGCAAGACG
CTGGGGGACGACAAGTCGGTGCTGGACATTATGAGCGCGGGGACGATTGAGGGACTGGGCAGGCTGGCTGTCGTG
TCGCTGCAGAAGAAGCACGGGGTCGGGGTCGAGGCATGA
Transcript >Hirsu2|9187
ATGGGGCTCGGCAGAGCCCATCTGGCCTACCGGAGCTTCTCCATCGTCGGAGACGGCGCGGTCGAGACGCTAACG
TTCAGTCCCTTCGAGAAGGTCGGCACCGGCAAAGTCGCCTTCGCCTTCACAGGTCAAGGCGCCCAGTGGGAGGGC
ATGGCGAGGAGCCTCATCCACGCCTCTCCGTCCTTCCGCAGGGACATTCGGGAGATGGACGCCGCGCTGCGTAGC
CTGAGCGAATGGACGATCGAAGACCTCCTCAGCTCCGGCATCGACGGTGAGCAGGACTATATCAACAAGACCGAG
TTCGCACAGCCTCTCTGCACGGCTGTCCAGATCGCCGTGGTGAACTTCCTGGCCAGGTGCGGCATAACCCCCTGT
GCCGTTGTCGGCCACTCCAGCGGGGAGATTGCGGCCGCCTATGCCGCCGGAGCCCTGACGGCGTCCGAGGCCATC
GTCTTCGCCTTTGCTCGCGGGCAGGCGACGCGGCTCAAAGGCCGGACGGGCCTCATGGCGGCCGTCGGGCTGGGC
CGCAACGCCGTCCTGCCGCATCTCGCTGAGGGCGCAATCATCGCCTGTGAGAATAGCGCGCAGAGCGTGACCGTA
TCGGGCGACCCGGAGGCCGTCAGACAGACGCTGGAGACGATCAAGGCCGAGGTTCCCGACACATTCGCCCGCCTC
CTCCACGTCAACGTGGCCTATCACTCGCACCACATGCGTGATGTTGGCGCCAAGTACGAAGAGCTGTTGGCGCCC
TATGCAAAGGAAGGCAGGGAGACGGGCATGCCGGCCGTGCCCTTTTTCTCGAGCGTCTACGGCAAAGCCCTCCCC
GCCGAGACTCGGCTCGACCGGACGTACTGGCGGAAGAATCTCGAGTCGCCCGTCTTGTTCCTCGCGGCCGCTTCC
AGTCTGCTGACCGGCGTGCCGGACGTGGCCACAGTGCTCGAGATCGGCCCCCATTCCGCCCTCCGCGGGCCACTT
CGCCAGATCTTCCAGGAACGGAACCCCAAGAGGGGGCCATCATACGTGCCAACCCTGGTTCGGAACAACGACTGC
ATCAGCTCGATTCTGGATACCGTCGGTCAGCTGTATGTGCGTGGCCACGCCGTTGACTTCTCCTTTCTCAACTCG
GCGACATCGATGCTGGTCGACCTGCCCAACTACCCTTGGGACCACAGTGAGGAGTACTGGAAGGAGAGCCGTGTG
TCGGAGGCATGGCGAATGAAGGGACACAGACACCACGAGGTTCTCGGCGACAAATGCGCGGTAGCTTCCAGTCTT
GAGCCCGTTTGGCGGAACGTGTTCCACCACTCCGACGTCCCCTGGCTCGCGGATCACAAGGTCGAGACGAATGTC
GTCTTTCCGTGCGCCGGCTACGTCGCCGTGATGGGTGAGGCTGTCCGGCAGGCCCTATGCTCCAACGGCTATGAG
CTGCGGAACCTGACAGTCAAGGCGGCCCTGGTGCTGCCCGAGACCGAAGTCGTCGAGATGATGACGACGATGCGA
CCCGCGCGCCTGACCGACCTGACCAACTCGCCGTCCTGGCACGATATATGCATCTCCACCTTCAACGGGACGGCC
TGGACGGAGAACTGCACTGCCCAGGGCAGGGCGGCCGGGGGGGACGGGGGCTGGCCGGGGGAGACGGGTCCTCGG
CTCACGGGCCCCTATTCGCGGCAGATACCCAAGAGCTATTTCTATGACCGCGTGCGCCATCTCGGCCTGAGATTA
GGCCCGCGCTTCCAGGGCATGACGGACATCTCGGCCGATACGGAGCGGCAGGCGGCGGCGGCGGCGTTTCGCGAT
GACGCGGCCGAGTACGAGGCGCCGTACGCCGCCCATCCCACGACCATCGACTGCTGTCTTCAGCTCTGCATCGTG
TCCAGCTGCCGCGGAGTGGCCCGCAACATGGACACGTTAGCCCTCCCGATCGGCATCCGGCGCGTCGTCGTAATC
CCCGGCAAAGAGCCAGACCTTGTGGCATCGGCCGAGACGGACCCGGCCAGCGCGACAGCAAGCGCCGTCGCGCTC
GCCAAGGACAGCCGGCGCCCCATTATCGTGCTCGAGAACGCCAGATGCATCCCGTTCGACACCGGAGACGACTCG
GACGGCCGCGACAGCCTCACCTCGGCGCGCCTTGAGTGGCTCCCCGACATCGACTGCCTCCCGTCTACGGACGAC
CTGATCTGGCGCGGGGACGGCAGGCGGAAGCAGCACCTGGCCAGCGAGAGGCTCACGTCGCTGGGGATCCTGCAG
ACGCTCCACGTGTTGAAGTCGCTCGAGGTGTCGCCCTCGGGCCACCTGGCCAAGTACGTCGCCTGGCTGGAGGAG
GAGAAGCAGGCCATGGTAAGCGGCGACAGGCCCCTCGCGTTGCCCGAAGAGCGGGAATGGGCGTCGATGGAGCCC
AGCGCGCTGAAGCTTCTCGCCAGCTCGGCGCTGGAGGAGCTCGAGGCCCTCGGCGACGGCACGGTCACCAGCGTG
GGCCGGATGCTGTACGACATGGCGCAGCAGGAGGCCATCGAGCCCATCTTCGGACGAGGCGCGAACCCTGAGCAG
CCCATCGTGGCCGGCGGGCGCATCAACGACCTCTACACGTCCCTGCAAACGCCAGCCAACGCGGCCGAGTTCTTC
CGTCTCTGCGGCCACGCCAAGCCGACGATGAAGGTGCTGGAGATCGGTGCCGGCACCGGCAGCACCACCGAGCAG
ATCCTGAACTCGCTCGTGTCCGACGACGACATCCGACTGTACGGACAGTACATCTTCACGGACATCTCGTCCTCC
TTTTTCACCGACGCCAGCAAGCGCTTCGAGGACCGGGGCGGCATGGCGTACAAGGCCCTGGACATCACAAAGAGC
CCGGCCGAGCAGGGTTTCGAGCTCGGCTCCTTCGATCTCGTCGTTGCCGCCAACGTGCTGCACGCCACGCCCTCG
CTACAGGAGAGCCTGCAGAACGTCCGGTCGCTGCTCCGGCCCGACGGCCGCCTGTATCTCGTCGAGCTGGCCAAG
CCGCTCGCGTGGCGGACCGTAGGCTTTGTTGCCGGCCGGCTTCCTGGGTGGTGGCTGGGAGAGGAGGACGGCCGG
GCCGACGTGCCCTTCGTCTCTGTCGACCGATGGGACGCCGAGCTCCGGGCTGCGGGTTTCTCCGGCGCCGAGTCC
TCCGTGCTCGACGACGAGGCGCCGTACAGCACGTCCGCCCATATCACGAGCAGAGTCGCTGCGGCGCTTCCCCAG
CCGGAAGCCGTGACGATCCTGTACCGAGAGGCCAGGCATGAGCTGGCCTGTAGCCTGGCCGACGCCTTGGCTGCA
GACGGTGTCGCCGTCCACTGGGCGCGGCTCGGCAGCGGCGAGGGTCTTGATAACGTGCAGCACGTGATCGCAGCC
GTCGACCTGGAGCGCCCCTTCTTCGACGACATCGCCGAGCCTGACTACCAGGCCTTCATGGCCCTCCTCGCCGGC
CTCAAGGGCGGCATCCTGTGGCTCACCGGCTCTGCCCAGATCGCCTGTACCGACCCTCGCTATGGCTTGGTCAAC
GGGGTGGCCCGGACGGCGCGGGTCGAGCTGTCTGTCGACTTCTGGACGGCGGAGCTGCAGAGGCCGGACGCGTCG
GCCTTGAAGGCCATCATGGCCATCGCCCGCAAGTTCTTCGGCCGCGCGCCTCTGAGCCGAGGCACCGATACCGAG
TTCGCCGTCCACGACGGCATGGTCCGCACCGCCCGCTGCCACTGGACCTCGCTGACCGGTGCCCTGGAGCCTGAG
GCGGACGACGGCGGCGCGAGGCAGATGGTCATCGGTCAGTACGGCGCGATCGACTCGTTGCACTGGGTCCGGTCC
GATCCGGGCTCGCTCCAGGCTCATGAAGTCGAGGTCGACATCCGGTGCGTTGGGCTTAACTTCAGGGACAATATG
GTCGCCATGGGCCTGTTGCCGATGCCCAAGGACAAGCTCGGGTTTGAGGCTGGCGCAGTCGTTTGCCGCGTGGGA
TCGGCCGTCGACCACGTCGCTGTGGGCGATCGCGTCTGTGTCCTGAACACTGGCCTCTTCGCGACCCGCAAGGTC
GTTGCGGGACACTGCGTCTTCCGTATACCGGACAACTTGACGTTGGCAGACGCTGCTACCGTCCCCGTCGTCTAC
GGAACTGCGATAGCCGTCTTGATCTACCAGGGACAGCTGCAGCGAGGCCAGTCTGTCTTGATACACTCTGCCGCC
GGTGGAGTCGGGCAGGCGGCTATCAACATCTGCCAGATGCTGGGTGCCGAGATCTTCGCGACAGTGGGAAGTGAA
AAGAAGGCCGGATTTCTCGTCGAAAACTACGGCATCGTGCGCGAGAGGATATTCAACTCCCGCAGCGCTTCGTTC
CTGGACGACGTCATGCGGGCTACGCAGGACCGAGGTGTTGATATCGTCCTGAACGCCCTATCCGGTGATCTGCTG
CACGCCTCCTGGAAGTGCGTCGCCAAGGGTGGCAAGATGATGGAGATCGGCAAGCGAGATATCCTCGAGCGCGGC
CGCCTGGATCTCGACGGCTTCCAGGACAACCGGTCCTTCCACAGCTTTGACCTGCACTACCTGCTCAAGGAGCAA
CCCGATGTCTGCACCGACATCTTGCGCCGGTCCTGGGAATGGGCGAGCGAGGGCCATATCAAGCCCATCCAGCCG
ATCCACGAATACCCGGTCCAAAATCTGCCGGACGCCGTGCGGTTCATGAGGACAGGCGAGCATATCGGCAAGATC
GTCGCCACGATTCCTGGTAATCCGGCTAGTATTCCGGCCACAAACGTTGCCGGGCCGGGCCTGCTATCGGACACG
TCGACCTATCTCCTAGTCGGCGGCCTAGGCGGCCTAGGCAAGGCCGTGACCCGCTGGCTGGTGGAGAGGGGCGCT
CGAAGCCTATGCTTCCTCTCTCGCTCGGCCGGCGCGTCGGAGCAGGACCAGGTCTTCTTTAGGGAGCTCGAGTCG
CAGGGCTGCCGCGTGGCGACTGTAGCTGGCAGTGTCGCGGACATGGCCGACGTCCGGAAGGCCGTCGAGGCCGCG
CCGACGCTCATCGGCGGCGTGCTGCAACTGTCCATGGTCCTTCGGGACCGAGCCTTCCTCCAGATGAGCTACGAC
GACTGGAGAGCAGCGCAAGAACCCAAGGTCAGGGGCACGTGGAATCTTCACACGGCCCTTGCCGAGACGAAGCTC
GACTTCTTCATTCTTCTGTCCTCGATCTCGGGCACCGTCGGTCAGCCGGGACAGGCCAATTACGCCTCGGCCAAC
TCTTTTCTCGACTCGTTCGTCCAGTATCGCCACGGCCTCGGCCTGCCCTGTTCGGTGATTGACCTGGGCGCGATG
GAGGGCATCGGCTACCTGAGCGACAAGCGGGCCAGGCTGGACCAGTACAAGTCGTTTGGCGCGCACGTGCTGCAG
GAGCGGCACCTCGTCGACGCGATCCAGCTGGCCATGAAGCGTTCCGTACCGACCAACGACACCGACCCGGCCAGC
CCGCGAGGTCCGTTGACGAATATGAGCCAGCTCATCGTCGGCTTGACCTCGACCAAGGCGCCATCGGATCCGACG
AATCGCACCGCCTTCAGACATGACGTCCGCGTCGGCATTTACAACAACATGGTGACTGGCAGCGAGGCGACGGCC
CTGTCGAAAGATCAGGGGATGAGTCGGCTCGTCAGCCAGTTTGAGGCCAACCCGGGACTCCTTGCCGATCCGGAC
GCCGTGAGCCAGGTGTCGCTGGAGCTCGGCCGGCTTTTGTTCCGGCTCCTGCTGCTCCCGGAGGAGACGCTGGAC
ACGAGCATGTCGCTCGCCTCTATCGGAATCGACTCGCTGGCAAGTATCGAGATCCGCAACTGGTGGCGCAAGACG
CTGGGGGACGACAAGTCGGTGCTGGACATTATGAGCGCGGGGACGATTGAGGGACTGGGCAGGCTGGCTGTCGTG
TCGCTGCAGAAGAAGCACGGGGTCGGGGTCGAGGCATGA
Gene >Hirsu2|9187
ATGGGGCTCGGCAGAGCCCATCTGGCCTACCGGAGCTTCTCCATCGTCGGAGACGGCGCGGTCGAGACGCTAACG
TTCAGTCCCTTCGAGAAGGTCGGCACCGGCAAAGTCGCCTTCGCCTTCACAGGTCAAGGCGCCCAGTGGGAGGGC
ATGGCGAGGAGCCTCATCCACGCCTCTCCGTCCTTCCGCAGGGACATTCGGGAGATGGACGCCGCGCTGCGTAGC
CTGAGCGAATGGACGATCGAAGGTATGCCGGAGTCTTGGGCCAAGTCACGATGCAACTGCTGACATGAAGAGAAC
AGACCTCCTCAGCTCCGGCATCGACGGTGAGCAGGACTATATCAACAAGACCGAGTTCGCACAGCCTCTCTGCAC
GGCTGTCCAGATCGCCGTGGTGAACTTCCTGGCCAGGTGCGGCATAACCCCCTGTGCCGTTGTCGGCCACTCCAG
CGGGGAGATTGCGGCCGCCTATGCCGCCGGAGCCCTGACGGCGTCCGAGGCCATCGTCTTCGCCTTTGCTCGCGG
GCAGGCGACGCGGCTCAAAGGCCGGACGGGCCTCATGGCGGCCGTCGGGCTGGGCCGCAACGCCGTCCTGCCGCA
TCTCGCTGAGGGCGCAATCATCGCCTGTGAGAATAGCGCGCAGAGCGTGACCGTATCGGGCGACCCGGAGGCCGT
CAGACAGACGCTGGAGACGATCAAGGCCGAGGTTCCCGACACATTCGCCCGCCTCCTCCACGTCAACGTGGCCTA
TCACTCGCGTACGTCGCGGTATCCATCACTTTCCCAGTGGCAGCGAGCTGACTCTGGCTTTCAGACCACATGCGT
GATGTTGGCGCCAAGTACGAAGAGCTGTTGGCGCCCTATGCAAAGGAAGGCAGGGAGACGGGCATGCCGGCCGTG
CCCTTTTTCTCGAGCGTCTACGGCAAAGCCCTCCCCGCCGAGACTCGGCTCGACCGGACGTACTGGCGGAAGAAT
CTCGAGTCGCCCGTCTTGTTCCTCGCGGCCGCTTCCAGTCTGCTGACCGGCGTGCCGGACGTGGCCACAGTGCTC
GAGATCGGCCCCCATTCCGCCCTCCGCGGGCCACTTCGCCAGATCTTCCAGGAACGGAACCCCAAGAGGGGGCCA
TCATACGTGCCAACCCTGGTTCGGAACAACGACTGCATCAGCTCGATTCTGGATACCGTCGGTCAGCTGTATGTG
CGTGGCCACGCCGTTGACTTCTCCTTTCTCAACTCGGCGACATCGATGCTGGTCGACCTGCCCAACTACCCTTGG
GACCACAGTGAGGAGTACTGGAAGGAGAGCCGTGTGTCGGAGGCATGGCGAATGAAGGGACACAGACACCACGAG
GTTCTCGGCGACAAATGCGCGGTAGCTTCCAGTCTTGAGCCCGTTTGGCGGAACGTGTTCCACCACTCCGACGTC
CCCTGGCTCGCGGATCACAAGGTCGAGACGAATGTCGTCTTTCCGTGCGCCGGCTACGTCGCCGTGATGGGTGAG
GCTGTCCGGCAGGCCCTATGCTCCAACGGCTATGAGCTGCGGAACCTGACAGTCAAGGCGGCCCTGGTGCTGCCC
GAGACCGAAGTCGTCGAGATGATGACGACGATGCGACCCGCGCGCCTGACCGACCTGACCAACTCGCCGTCCTGG
CACGATATATGCATCTCCACCTTCAACGGGACGGCCTGGACGGAGAACTGCACTGCCCAGGGCAGGGCGGCCGGG
GGGGACGGGGGCTGGCCGGGGGAGACGGGTCCTCGGCTCACGGGCCCCTATTCGCGGCAGATACCCAAGAGCTAT
TTCTATGACCGCGTGCGCCATCTCGGCCTGAGATTAGGCCCGCGCTTCCAGGGCATGACGGACATCTCGGCCGAT
ACGGAGCGGCAGGCGGCGGCGGCGGCGTTTCGCGATGACGCGGCCGAGTACGAGGCGCCGTACGCCGCCCATCCC
ACGACCATCGACTGCTGTCTTCAGCTCTGCATCGTGTCCAGCTGCCGCGGAGTGGCCCGCAACATGGACACGTTA
GCCCTCCCGATCGGCATCCGGCGCGTCGTCGTAATCCCCGGCAAAGAGCCAGACCTTGTGGCATCGGCCGAGACG
GACCCGGCCAGCGCGACAGCAAGCGCCGTCGCGCTCGCCAAGGACAGCCGGCGCCCCATTATCGTGCTCGAGAAC
GCCAGATGCATCCCGTTCGACACCGGAGACGACTCGGACGGCCGCGACAGCCTCACCTCGGCGCGCCTTGAGTGG
CTCCCCGACATCGACTGCCTCCCGTCTACGGACGACCTGATCTGGCGCGGGGACGGCAGGCGGAAGCAGCACCTG
GCCAGCGAGAGGCTCACGTCGCTGGGGATCCTGCAGACGCTCCACGTGTTGAAGTCGCTCGAGGTGTCGCCCTCG
GGCCACCTGGCCAAGTACGTCGCCTGGCTGGAGGAGGAGAAGCAGGCCATGGTAAGCGGCGACAGGCCCCTCGCG
TTGCCCGAAGAGCGGGAATGGGCGTCGATGGAGCCCAGCGCGCTGAAGCTTCTCGCCAGCTCGGCGCTGGAGGAG
CTCGAGGCCCTCGGCGACGGCACGGTCACCAGCGTGGGCCGGATGCTGTACGACATGGCGCAGCAGGAGGCCATC
GAGCCCATCTTCGGACGAGGCGCGAACCCTGAGCAGCCCATCGTGGCCGGCGGGCGCATCAACGACCTCTACACG
TCCCTGCAAACGCCAGCCAACGCGGCCGAGTTCTTCCGTCTCTGCGGCCACGCCAAGCCGACGATGAAGGTGCTG
GAGATCGGTGCCGGCACCGGCAGCACCACCGAGCAGATCCTGAACTCGCTCGTGTCCGACGACGACATCCGACTG
TACGGACAGTACATCTTCACGGACATCTCGTCCTCCTTTTTCACCGACGCCAGCAAGCGCTTCGAGGACCGGGGC
GGCATGGCGTACAAGGCCCTGGACATCACAAAGAGCCCGGCCGAGCAGGGTTTCGAGCTCGGCTCCTTCGATCTC
GTCGTTGCCGCCAACGTGCTGCACGCCACGCCCTCGCTACAGGAGAGCCTGCAGAACGTCCGGTCGCTGCTCCGG
CCCGACGGCCGCCTGTATCTCGTCGAGCTGGCCAAGCCGCTCGCGTGGCGGACCGTAGGCTTTGTTGCCGGCCGG
CTTCCTGGGTGGTGGCTGGGAGAGGAGGACGGCCGGGCCGACGTGCCCTTCGTCTCTGTCGACCGATGGGACGCC
GAGCTCCGGGCTGCGGGTTTCTCCGGCGCCGAGTCCTCCGTGCTCGACGACGAGGCGCCGTACAGCACGTCCGCC
CATATCACGAGCAGAGTCGCTGCGGCGCTTCCCCAGCCGGAAGCCGTGACGATCCTGTACCGAGAGGCCAGGCAT
GAGCTGGCCTGTAGCCTGGCCGACGCCTTGGCTGCAGACGGTGTCGCCGTCCACTGGGCGCGGCTCGGCAGCGGC
GAGGGTCTTGATAACGTGCAGCACGTGATCGCAGCCGTCGACCTGGAGCGCCCCTTCTTCGACGACATCGCCGAG
CCTGACTACCAGGCCTTCATGGCCCTCCTCGCCGGCCTCAAGGGCGGCATCCTGTGGCTCACCGGCTCTGCCCAG
ATCGCCTGTACCGACCCTCGCTATGGCTTGGTCAACGGGGTGGCCCGGACGGCGCGGGTCGAGCTGTCTGTCGAC
TTCTGGACGGCGGAGCTGCAGAGGCCGGACGCGTCGGCCTTGAAGGCCATCATGGCCATCGCCCGCAAGTTCTTC
GGCCGCGCGCCTCTGAGCCGAGGCACCGATACCGAGTTCGCCGTCCACGACGGCATGGTCCGCACCGCCCGCTGC
CACTGGACCTCGCTGACCGGTGCCCTGGAGCCTGAGGCGGACGACGGCGGCGCGAGGCAGATGGTCATCGGTCAG
TACGGCGCGATCGACTCGTTGCACTGGGTCCGGTCCGATCCGGGCTCGCTCCAGGCTCATGAAGTCGAGGTCGAC
ATCCGGTGCGTTGGGCTTAACTTCAGGGTATGGTGACCTGTGATGGCCGTGCTCGCGCTTCGCTGACCTAACCAC
GTATAGGACAATATGGTCGCCATGGGCCTGTTGCCGATGCCCAAGGACAAGCTCGGGTTTGAGGCTGGCGCAGTC
GTTTGCCGCGTGGGATCGGCCGTCGACCACGTCGCTGTGGGCGATCGCGTCTGTGTCCTGAACACTGGCCTCTTC
GCGACCCGCAAGGTCGTTGCGGGACACTGCGTCTTCCGTATACCGGACAACTTGACGTTGGCAGACGCTGCTACC
GTCCCCGTCGTCTACGGAACTGCGATAGCCGTCTTGATCTACCAGGGACAGCTGCAGCGAGGCCAGGTGAGAGAG
AGCGCGCGACACGGCGTAGAGGAGGAAGCTAACGTCTCAAGTCTGTCTTGATACACTCTGCCGCCGGTGGAGTCG
GGCAGGCGGCTATCAACATCTGCCAGATGCTGGGTGCCGAGGTGAGTACATCTTCACCCGATGTCGATCTCGTGG
CTTCAGATGCGGTTCTTGTCGCTGATGACTATTGTTTTTTTTTTTCAGATCTTCGCGACAGTGGGAAGTGAAAAG
AAGGCCGGATTTCTCGTCGAAAACTACGGCATCGTGCGCGAGAGGATATTCAACTCCCGCAGCGCTTCGTTCCTG
GACGACGTCATGCGGGCTACGCAGGACCGAGGTGTTGATATCGTCCTGAACGCCCTATCCGGTGATCTGCTGCAC
GCCTCCTGGAAGTGCGTCGCCAAGGGTGGCAAGATGATGGAGATCGGCAAGCGAGATATCCTCGAGCGCGGCCGC
CTGGATCTCGACGGCTTCCAGGACAACCGGTCCTTCCACAGCTTTGACCTGCACTACCTGCTCAAGGAGCAACCC
GATGTCTGCACCGAGTAAGACCACTCCAACTGTTGCGCCGCACGCATGGCTGACGACATGTGTGACAAAATACAG
CATCTTGCGCCGGTCCTGGGAATGGGCGAGCGAGGGCCATATCAAGCCCATCCAGCCGATCCACGAATACCCGGT
CCAAAATCTGCCGGACGCCGTGCGGTTCATGAGGACAGGCGAGCATATCGGCAAGATCGTCGCCACGATTCCTGG
TAATCCGGCTAGTATTCCGGCCACAAACGTTGCCGGGCCGGGCCTGCTATCGGACACGTCGACCTATCTCCTAGT
CGGCGGCCTAGGCGGCCTAGGCAAGGCCGTGACCCGCTGGCTGGTGGAGAGGGGCGCTCGAAGCCTATGCTTCCT
CTCTCGCTCGGCCGGCGCGTCGGAGCAGGACCAGGTCTTCTTTAGGGAGCTCGAGTCGCAGGGCTGCCGCGTGGC
GACTGTAGCTGGCAGTGTCGCGGACATGGCCGACGTCCGGAAGGCCGTCGAGGCCGCGCCGACGCTCATCGGCGG
CGTGCTGCAACTGTCCATGGTCCTTCGGGTGAGCATGCCCGCCCCTGGCGACCCTCGCAGTGTACGCAAGGGCCG
AACACTGCATGGCGTTGGCTAACTTGTCACTTCGTCGTTCAGGACCGAGCCTTCCTCCAGATGAGCTACGACGAC
TGGAGAGCAGCGCAAGAACCCAAGGTCAGGGGCACGTGGAATCTTCACACGGCCCTTGCCGAGACGAAGCTCGAC
TTCTTCATTCTTCTGTCCTCGATCTCGGGCACCGTCGGTCAGCCGGGACAGGCCAATTACGCCTCGGCCAACTCT
TTTCTCGACTCGTTCGTCCAGTATCGCCACGGCCTCGGCCTGCCCTGTTCGGTGATTGACCTGGGCGCGATGGAG
GGCATCGGCTACCTGAGCGACAAGCGGGCCAGGCTGGACCAGTACAAGTCGTTTGGCGCGCACGTGCTGCAGGAG
CGGCACCTCGTCGACGCGATCCAGCTGGCCATGAAGCGTTCCGTACCGACCAACGACACCGACCCGGCCAGCCCG
CGAGGTCCGTTGACGAATATGAGCCAGCTCATCGTCGGCTTGACCTCGACCAAGGCGCCATCGGATCCGACGAAT
CGCACCGCCTTCAGACATGACGTCCGCGTCGGCATTTACAACAACATGGTGACTGGCAGCGAGGCGACGGCCCTG
TCGAAAGATCAGGGGATGAGTCGGCTCGTCAGCCAGTTTGAGGCCAACCCGGGACTCCTTGCCGATCCGGACGCC
GTGAGCCAGGTGTCGCTGGAGCTCGGCCGGCTTTTGTTCCGGCTCCTGCTGCTCCCGGAGGAGACGCTGGACACG
AGCATGTCGCTCGCCTCTATCGGAATCGACTCGCTGGCAAGTATCGAGATCCGCAACTGGTGGCGCAAGACGCTG
GGGGACGACAAGTCGGTGCTGGACATTATGAGCGCGGGGACGATTGAGGGACTGGGCAGGCTGGCTGTCGTGTCG
CTGCAGAAGAAGCACGGGGTCGGGGTCGAGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail