Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|917
Gene name
LocationContig_1191:109..524
Strand-
Gene length (bp)415
Transcript length (bp)363
Coding sequence length (bp)363
Protein length (aa) 121

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03366 YEATS YEATS family 3.4E-25 44 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7S1|AF9_GIBZE Protein AF-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YAF9 PE=3 SV=1 1 118 2.0E-73
sp|Q7RZK7|AF9_NEUCR Protein AF-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yaf9 PE=3 SV=1 1 118 3.0E-56
sp|Q4WPM8|AF9_ASPFU Protein AF-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yaf9 PE=3 SV=2 3 118 3.0E-36
sp|Q5BC71|AF9_EMENI Protein AF-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yaf9 PE=3 SV=1 3 118 2.0E-32
sp|P53930|AF9_YEAST Protein AF-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAF9 PE=1 SV=1 1 114 6.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7S1|AF9_GIBZE Protein AF-9 homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YAF9 PE=3 SV=1 1 118 2.0E-73
sp|Q7RZK7|AF9_NEUCR Protein AF-9 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yaf9 PE=3 SV=1 1 118 3.0E-56
sp|Q4WPM8|AF9_ASPFU Protein AF-9 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yaf9 PE=3 SV=2 3 118 3.0E-36
sp|Q5BC71|AF9_EMENI Protein AF-9 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yaf9 PE=3 SV=1 3 118 2.0E-32
sp|P53930|AF9_YEAST Protein AF-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAF9 PE=1 SV=1 1 114 6.0E-28
sp|Q755P0|AF9_ASHGO Protein AF-9 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YAF9 PE=3 SV=1 1 114 2.0E-27
sp|Q6FXM4|AF9_CANGA Protein AF-9 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YAF9 PE=3 SV=1 1 114 2.0E-25
sp|Q6CIV8|AF9_KLULA Protein AF-9 homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAF9 PE=3 SV=1 3 114 8.0E-25
sp|Q10319|AF9_SCHPO Protein AF-9 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yaf9 PE=3 SV=1 1 118 1.0E-24
sp|Q59LC9|AF9_CANAL Protein AF-9 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YAF9 PE=3 SV=1 8 107 1.0E-17
sp|P0CM08|AF9_CRYNJ Protein AF-9 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YAF9 PE=3 SV=1 8 118 5.0E-15
sp|P0CM09|AF9_CRYNB Protein AF-9 homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YAF9 PE=3 SV=1 8 118 5.0E-15
sp|O95619|YETS4_HUMAN YEATS domain-containing protein 4 OS=Homo sapiens GN=YEATS4 PE=1 SV=1 8 97 1.0E-13
sp|Q9CR11|YETS4_MOUSE YEATS domain-containing protein 4 OS=Mus musculus GN=Yeats4 PE=2 SV=1 8 97 2.0E-13
sp|Q9FH40|TA14B_ARATH Transcription initiation factor TFIID subunit 14b OS=Arabidopsis thaliana GN=TAF14B PE=1 SV=1 1 118 2.0E-12
sp|Q4PFI5|AF9_USTMA Protein AF-9 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YAF9 PE=3 SV=1 58 118 3.0E-12
sp|F4IPK2|TAF14_ARATH Transcription initiation factor TFIID subunit 14 OS=Arabidopsis thaliana GN=TAF14 PE=1 SV=1 9 118 5.0E-12
sp|Q6CF24|AF9_YARLI Protein AF-9 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YAF9 PE=3 SV=1 62 114 7.0E-09
sp|A2AM29|AF9_MOUSE Protein AF-9 OS=Mus musculus GN=Mllt3 PE=1 SV=1 44 110 1.0E-07
sp|P42568|AF9_HUMAN Protein AF-9 OS=Homo sapiens GN=MLLT3 PE=1 SV=2 44 110 1.0E-07
sp|Q03111|ENL_HUMAN Protein ENL OS=Homo sapiens GN=MLLT1 PE=1 SV=2 39 110 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0031326 regulation of cellular biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|917
MAPSNHLGKRVKLTQIRRPFVVGSTAQPFSDTNPKPAGTPDNHTHSWQVFVKGLEDVDMTYWVRRVQFKLHESIP
NYVRMVEGEAGRPFAVHETGWGEFDITIKLYYVNESGEKPQTLPW*
Coding >Hirsu2|917
ATGGCGCCGTCCAACCACCTGGGCAAGCGCGTCAAGCTGACGCAGATCCGGCGGCCGTTCGTCGTCGGCAGCACG
GCGCAGCCCTTCTCGGACACGAACCCGAAGCCGGCCGGGACGCCCGACAACCACACGCACTCGTGGCAGGTGTTC
GTCAAGGGGCTCGAGGACGTGGACATGACGTACTGGGTGCGGCGGGTGCAGTTCAAGCTGCACGAGTCGATACCC
AACTACGTGCGGATGGTGGAGGGCGAGGCCGGGCGGCCCTTCGCCGTGCACGAGACGGGCTGGGGCGAGTTCGAC
ATCACCATCAAGCTCTACTACGTCAACGAGTCGGGCGAGAAGCCGCAGACGCTGCCATGGTGA
Transcript >Hirsu2|917
ATGGCGCCGTCCAACCACCTGGGCAAGCGCGTCAAGCTGACGCAGATCCGGCGGCCGTTCGTCGTCGGCAGCACG
GCGCAGCCCTTCTCGGACACGAACCCGAAGCCGGCCGGGACGCCCGACAACCACACGCACTCGTGGCAGGTGTTC
GTCAAGGGGCTCGAGGACGTGGACATGACGTACTGGGTGCGGCGGGTGCAGTTCAAGCTGCACGAGTCGATACCC
AACTACGTGCGGATGGTGGAGGGCGAGGCCGGGCGGCCCTTCGCCGTGCACGAGACGGGCTGGGGCGAGTTCGAC
ATCACCATCAAGCTCTACTACGTCAACGAGTCGGGCGAGAAGCCGCAGACGCTGCCATGGTGA
Gene >Hirsu2|917
ATGGCGCCGTCCAACCACCTGGGCAAGCGCGTCAAGCTGACGCAGATCCGGCGGCCGTTCGTCGTCGGCAGCACG
GCGCAGCCCTTCTCGGACACGAACCCGAAGCCGGCCGGGACGCCCGACAACCACACGCACTCGTGGCAGGTGTTC
GTCAAGGGGCTCGAGGACGTGGACATGACGTACTGGGTGCGGCGGGTGCAGTTCAAGCTGCACGAGTCGATACCC
AACTACGTGCGGATGGTGGAGGGCGAGGCCGGGCGGCCCTTCGCCGTGCACGAGACGGGCTGGGGCGAGTTCGAC
ATCACCATCAAGCTCTACTACGTCAACGAGTCGGGCGAGAAGCCGCAGACGCTGTACCACTACCTGCGCCTGCAC
CCCTTCGGCCGCACCGACGAGGAGAAGCAGGCCATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail