Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|9167
Gene name
LocationContig_648:8768..9342
Strand+
Gene length (bp)574
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10247 Romo1 Reactive mitochondrial oxygen species modulator 1 1.2E-27 16 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02889|MGR2_YEAST Protein MGR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGR2 PE=1 SV=1 1 97 8.0E-22
sp|P79082|MGR2_SCHPO Protein mgr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mgr2 PE=2 SV=1 15 89 5.0E-19
sp|A4QNF3|ROMO1_XENTR Reactive oxygen species modulator 1 OS=Xenopus tropicalis GN=romo1 PE=3 SV=1 6 81 8.0E-11
sp|Q6NYD1|ROMO1_DANRE Reactive oxygen species modulator 1 OS=Danio rerio GN=romo1 PE=3 SV=1 3 81 2.0E-10
sp|Q4V7T9|ROMO1_XENLA Reactive oxygen species modulator 1 OS=Xenopus laevis GN=romo1 PE=3 SV=1 6 81 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02889|MGR2_YEAST Protein MGR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGR2 PE=1 SV=1 1 97 8.0E-22
sp|P79082|MGR2_SCHPO Protein mgr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mgr2 PE=2 SV=1 15 89 5.0E-19
sp|A4QNF3|ROMO1_XENTR Reactive oxygen species modulator 1 OS=Xenopus tropicalis GN=romo1 PE=3 SV=1 6 81 8.0E-11
sp|Q6NYD1|ROMO1_DANRE Reactive oxygen species modulator 1 OS=Danio rerio GN=romo1 PE=3 SV=1 3 81 2.0E-10
sp|Q4V7T9|ROMO1_XENLA Reactive oxygen species modulator 1 OS=Xenopus laevis GN=romo1 PE=3 SV=1 6 81 3.0E-10
sp|P60603|ROMO1_MOUSE Reactive oxygen species modulator 1 OS=Mus musculus GN=Romo1 PE=2 SV=1 6 81 4.0E-10
sp|P60602|ROMO1_HUMAN Reactive oxygen species modulator 1 OS=Homo sapiens GN=ROMO1 PE=1 SV=1 6 81 4.0E-10
sp|Q3SZV8|ROMO1_BOVIN Reactive oxygen species modulator 1 OS=Bos taurus GN=ROMO1 PE=3 SV=1 6 81 4.0E-10
sp|A1XQR6|ROMO1_PIG Reactive oxygen species modulator 1 OS=Sus scrofa GN=ROMO1 PE=3 SV=1 6 81 4.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 57 79 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|9167
MPPVAAVNAGGHHGPSNFDKLKMGAMMGGTVGVIIGFIFGTVNIFRYGAGSHGIMRTLGQYMGASGATFGFFMSI
GSVIRSDADPQMHQLYMRAQRRPITMLANPAWRRP*
Coding >Hirsu2|9167
ATGCCTCCCGTCGCGGCAGTCAACGCTGGCGGCCATCACGGCCCTTCCAACTTCGACAAGCTCAAGATGGGCGCC
ATGATGGGCGGCACCGTCGGCGTCATCATCGGCTTCATATTTGGCACCGTCAATATCTTCCGGTACGGCGCTGGA
TCACACGGCATCATGCGCACTCTCGGCCAGTACATGGGCGCCTCGGGGGCTACCTTCGGCTTCTTCATGTCGATC
GGCAGCGTCATTCGCTCGGACGCCGACCCCCAGATGCATCAACTGTACATGCGAGCCCAGCGACGGCCCATCACG
ATGCTGGCGAACCCTGCGTGGCGGAGGCCGTGA
Transcript >Hirsu2|9167
ATGCCTCCCGTCGCGGCAGTCAACGCTGGCGGCCATCACGGCCCTTCCAACTTCGACAAGCTCAAGATGGGCGCC
ATGATGGGCGGCACCGTCGGCGTCATCATCGGCTTCATATTTGGCACCGTCAATATCTTCCGGTACGGCGCTGGA
TCACACGGCATCATGCGCACTCTCGGCCAGTACATGGGCGCCTCGGGGGCTACCTTCGGCTTCTTCATGTCGATC
GGCAGCGTCATTCGCTCGGACGCCGACCCCCAGATGCATCAACTGTACATGCGAGCCCAGCGACGGCCCATCACG
ATGCTGGCGAACCCTGCGTGGCGGAGGCCGTGA
Gene >Hirsu2|9167
ATGCCTCCCGTCGCGGCAGTCAACGCTGGCGGCCATCACGGCCCTTCCAACTTCGACAAGCGTACGATCTTTCGC
CTTGGCAGATGCGGCAGCGACTAACGGCATCGACTGCAGTCAAGATGGGCGCCATGATGGGCGGCAGTAGGCTTG
CCTCCGTGCCCTTCCCCTCACCGACCAGCCTGCTGATGCTGCTGCACTAGCCGTCGGCGTCATCATCGGCTTCAT
ATTTGGTGCGCAGCCTGCACACTAGGACGACGGCTGTCTCTCCGTACGAGCTCGGCGACCGGACTGACCCGCCGC
AGGCACCGTCAATATCTTCCGGTACGGCGCTGGATCACACGGCATCATGCGCACTCTCGGCCAGTACATGGGCGC
CTCGGGGGCTACCTTCGGGTCTGTGGAATCCGTTCTCGTTCCACTCGCCGTGGATACTGACCGAGGGCCGACTAG
CTTCTTCATGTCGATCGGCAGCGTCATTCGCTCGGACGCCGACCCCCAGATGCATCAACTGTACATGCGAGCCCA
GCGACGGCCCATCACGATGCTGGCGAACCCTGCGTGGCGGAGGCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail